BLASTX nr result
ID: Atractylodes21_contig00015403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015403 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002009367.1| GI15309 [Drosophila mojavensis] gi|193907817... 60 4e-07 ref|XP_002086848.1| GE19562 [Drosophila yakuba] gi|194185989|gb|... 58 1e-06 >ref|XP_002009367.1| GI15309 [Drosophila mojavensis] gi|193907817|gb|EDW06684.1| GI15309 [Drosophila mojavensis] Length = 255 Score = 59.7 bits (143), Expect = 4e-07 Identities = 50/166 (30%), Positives = 70/166 (42%) Frame = +1 Query: 79 SSSNRNSNPILNSRTGPNPSPIRNPDRYSNQASTSLSCFRSDDPANWNCNLLAALVSPKN 258 SSSN NSN NS + N + N + SN S S S S+ +N N N + S N Sbjct: 80 SSSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSN 139 Query: 259 RNSDPMLNSRPGPKPNRYSNQASTSLSRFRSDDPANWNCNLLAAIVRPKKSSASFPSLNG 438 NS+ NS N SN S S S S+ +N N N + S+++ S + Sbjct: 140 SNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSN 199 Query: 439 AQNNSVHALNRTHAPNSSTQVGSNSTGPSGVGSMVGNQQSHTFASN 576 + +NS N NS++ SNS S S + + SN Sbjct: 200 SNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSN 245 Score = 57.8 bits (138), Expect = 1e-06 Identities = 49/167 (29%), Positives = 71/167 (42%) Frame = +1 Query: 76 ASSSNRNSNPILNSRTGPNPSPIRNPDRYSNQASTSLSCFRSDDPANWNCNLLAALVSPK 255 +SSSN NSN NS + N + N + SN S S S S+ +N + N + S Sbjct: 33 SSSSNSNSNNNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSSSNSNSNSNSNS 92 Query: 256 NRNSDPMLNSRPGPKPNRYSNQASTSLSRFRSDDPANWNCNLLAAIVRPKKSSASFPSLN 435 N NS+ NS N SN S S S S+ +N N N + S+++ S + Sbjct: 93 NSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNS 152 Query: 436 GAQNNSVHALNRTHAPNSSTQVGSNSTGPSGVGSMVGNQQSHTFASN 576 + +NS N NS++ SNS S S + + SN Sbjct: 153 NSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSN 199 >ref|XP_002086848.1| GE19562 [Drosophila yakuba] gi|194185989|gb|EDW99600.1| GE19562 [Drosophila yakuba] Length = 276 Score = 58.2 bits (139), Expect = 1e-06 Identities = 49/165 (29%), Positives = 69/165 (41%) Frame = +1 Query: 82 SSNRNSNPILNSRTGPNPSPIRNPDRYSNQASTSLSCFRSDDPANWNCNLLAALVSPKNR 261 SSN NSN NS + N + N + SN S S S S+ +N N N + S N Sbjct: 36 SSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNS 95 Query: 262 NSDPMLNSRPGPKPNRYSNQASTSLSRFRSDDPANWNCNLLAAIVRPKKSSASFPSLNGA 441 NS+ NS N SN S S S S+ +N N N + S+++ S + + Sbjct: 96 NSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNS 155 Query: 442 QNNSVHALNRTHAPNSSTQVGSNSTGPSGVGSMVGNQQSHTFASN 576 +NS N NS++ SNS S S + + SN Sbjct: 156 NSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSN 200