BLASTX nr result
ID: Atractylodes21_contig00015316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015316 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC81814.1| CGI-144-like protein [Solanum lycopersicum] 110 1e-22 ref|XP_002451373.1| hypothetical protein SORBIDRAFT_04g000960 [S... 107 8e-22 gb|AFK37473.1| unknown [Medicago truncatula] 107 1e-21 ref|NP_001237188.1| uncharacterized protein LOC100500638 [Glycin... 107 1e-21 ref|XP_002513320.1| 7-dehydrocholesterol reductase, putative [Ri... 107 1e-21 >emb|CAC81814.1| CGI-144-like protein [Solanum lycopersicum] Length = 69 Score = 110 bits (275), Expect = 1e-22 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -2 Query: 352 ENLTPAERRYMEQRQQIDMHKMSKTSNKSHRDRISDFNQYLANMSEHYDIPKVGPG 185 +NLTPAERRY+EQR++IDMHKM+KT+NKSHRDRI DFNQYLANMSEHYDIPKVGPG Sbjct: 14 DNLTPAERRYIEQRERIDMHKMAKTANKSHRDRIEDFNQYLANMSEHYDIPKVGPG 69 >ref|XP_002451373.1| hypothetical protein SORBIDRAFT_04g000960 [Sorghum bicolor] gi|241931204|gb|EES04349.1| hypothetical protein SORBIDRAFT_04g000960 [Sorghum bicolor] Length = 136 Score = 107 bits (268), Expect = 8e-22 Identities = 52/71 (73%), Positives = 57/71 (80%) Frame = -2 Query: 397 MTQEETNTSKGASHIENLTPAERRYMEQRQQIDMHKMSKTSNKSHRDRISDFNQYLANMS 218 M EE N H LTPAERRYMEQ+Q+IDMHKM+K +NKSHRDRI DFNQYLAN+S Sbjct: 69 MGDEEGNPHPDYDH---LTPAERRYMEQKQKIDMHKMAKVANKSHRDRIQDFNQYLANLS 125 Query: 217 EHYDIPKVGPG 185 EHYDIPKVGPG Sbjct: 126 EHYDIPKVGPG 136 >gb|AFK37473.1| unknown [Medicago truncatula] Length = 136 Score = 107 bits (266), Expect = 1e-21 Identities = 48/68 (70%), Positives = 59/68 (86%) Frame = -2 Query: 388 EETNTSKGASHIENLTPAERRYMEQRQQIDMHKMSKTSNKSHRDRISDFNQYLANMSEHY 209 E + K A + ++LTPAERRY+EQR+Q+D+H+++K SNKSHRDRI DFNQYLANMSEHY Sbjct: 69 ELSREEKPAHYDDHLTPAERRYIEQREQLDVHRLAKISNKSHRDRIQDFNQYLANMSEHY 128 Query: 208 DIPKVGPG 185 DIPKVGPG Sbjct: 129 DIPKVGPG 136 >ref|NP_001237188.1| uncharacterized protein LOC100500638 [Glycine max] gi|255630831|gb|ACU15778.1| unknown [Glycine max] Length = 136 Score = 107 bits (266), Expect = 1e-21 Identities = 48/68 (70%), Positives = 59/68 (86%) Frame = -2 Query: 388 EETNTSKGASHIENLTPAERRYMEQRQQIDMHKMSKTSNKSHRDRISDFNQYLANMSEHY 209 E + K A + ++LTPAERRY+EQR+Q+D+H+++K SNKSHRDRI DFNQYLANMSEHY Sbjct: 69 ELSGKGKTAHYDDHLTPAERRYIEQREQLDVHRLAKISNKSHRDRIQDFNQYLANMSEHY 128 Query: 208 DIPKVGPG 185 DIPKVGPG Sbjct: 129 DIPKVGPG 136 >ref|XP_002513320.1| 7-dehydrocholesterol reductase, putative [Ricinus communis] gi|223547228|gb|EEF48723.1| 7-dehydrocholesterol reductase, putative [Ricinus communis] Length = 560 Score = 107 bits (266), Expect = 1e-21 Identities = 48/62 (77%), Positives = 57/62 (91%) Frame = -2 Query: 370 KGASHIENLTPAERRYMEQRQQIDMHKMSKTSNKSHRDRISDFNQYLANMSEHYDIPKVG 191 K AS+ + +TPAERRYMEQR++ID+H+M+K +NKSHRDRI DFNQYLANMSEHYDIPKVG Sbjct: 499 KTASYDDYMTPAERRYMEQREKIDIHRMAKEANKSHRDRIQDFNQYLANMSEHYDIPKVG 558 Query: 190 PG 185 PG Sbjct: 559 PG 560