BLASTX nr result
ID: Atractylodes21_contig00015089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015089 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534120.1| ef-hand calcium binding protein, putative [R... 93 3e-17 gb|AFW64764.1| grancalcin [Zea mays] 92 6e-17 gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] 92 6e-17 ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [S... 92 6e-17 gb|ACN31166.1| unknown [Zea mays] 92 6e-17 >ref|XP_002534120.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223525823|gb|EEF28264.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 266 Score = 92.8 bits (229), Expect = 3e-17 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 333 DNFIECCLTVKGLTEKFKEKDTSYMGSATFTYEAFMLTVLPFLIA 199 DNFIECCLTVKGLTEKFKEKDTSY GSATFTYEAFMLTVLPFLIA Sbjct: 222 DNFIECCLTVKGLTEKFKEKDTSYSGSATFTYEAFMLTVLPFLIA 266 >gb|AFW64764.1| grancalcin [Zea mays] Length = 296 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 333 DNFIECCLTVKGLTEKFKEKDTSYMGSATFTYEAFMLTVLPFLIA 199 DNFIECCLTVKGLTEKFKEKDT+Y GSATFTYEAFMLTVLPFLIA Sbjct: 252 DNFIECCLTVKGLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 296 >gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] Length = 84 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 333 DNFIECCLTVKGLTEKFKEKDTSYMGSATFTYEAFMLTVLPFLIA 199 DNFIECCLTVKGLTEKFKEKDT+Y GSATFTYEAFMLTVLPFLIA Sbjct: 40 DNFIECCLTVKGLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 84 >ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] gi|241936083|gb|EES09228.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] Length = 304 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 333 DNFIECCLTVKGLTEKFKEKDTSYMGSATFTYEAFMLTVLPFLIA 199 DNFIECCLTVKGLTEKFKEKDT+Y GSATFTYEAFMLTVLPFLIA Sbjct: 260 DNFIECCLTVKGLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 304 >gb|ACN31166.1| unknown [Zea mays] Length = 153 Score = 91.7 bits (226), Expect = 6e-17 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 333 DNFIECCLTVKGLTEKFKEKDTSYMGSATFTYEAFMLTVLPFLIA 199 DNFIECCLTVKGLTEKFKEKDT+Y GSATFTYEAFMLTVLPFLIA Sbjct: 109 DNFIECCLTVKGLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 153