BLASTX nr result
ID: Atractylodes21_contig00015079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00015079 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187873.1| CTP synthase [Arabidopsis thaliana] gi|12321972... 65 6e-09 gb|AFW83443.1| hypothetical protein ZEAMMB73_211552, partial [Ze... 65 6e-09 gb|AFW83442.1| hypothetical protein ZEAMMB73_211552 [Zea mays] 65 6e-09 gb|AFW83440.1| hypothetical protein ZEAMMB73_211552 [Zea mays] 65 6e-09 ref|XP_002884917.1| EMB2742 [Arabidopsis lyrata subsp. lyrata] g... 65 6e-09 >ref|NP_187873.1| CTP synthase [Arabidopsis thaliana] gi|12321972|gb|AAG51029.1|AC069474_28 CTP-synthetase, putative; 3708-7443 [Arabidopsis thaliana] gi|11994408|dbj|BAB02410.1| CTP synthase [Arabidopsis thaliana] gi|20260422|gb|AAM13109.1| CTP-synthetase, putative [Arabidopsis thaliana] gi|30725394|gb|AAP37719.1| At3g12670 [Arabidopsis thaliana] gi|332641709|gb|AEE75230.1| CTP synthase [Arabidopsis thaliana] Length = 591 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 409 QVVPHITDAIQGWIERVAAIPVDGKEGPPDVLIVD 513 QVVPH+TDAIQ WIERVA +PVDGKEGPPDV +++ Sbjct: 112 QVVPHVTDAIQEWIERVANVPVDGKEGPPDVCVIE 146 >gb|AFW83443.1| hypothetical protein ZEAMMB73_211552, partial [Zea mays] Length = 286 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 409 QVVPHITDAIQGWIERVAAIPVDGKEGPPDVLIVD 513 QVVPHITD IQ WIERVA IPVDGKEGPPDV +++ Sbjct: 112 QVVPHITDEIQDWIERVAVIPVDGKEGPPDVCVIE 146 >gb|AFW83442.1| hypothetical protein ZEAMMB73_211552 [Zea mays] Length = 487 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 409 QVVPHITDAIQGWIERVAAIPVDGKEGPPDVLIVD 513 QVVPHITD IQ WIERVA IPVDGKEGPPDV +++ Sbjct: 112 QVVPHITDEIQDWIERVAVIPVDGKEGPPDVCVIE 146 >gb|AFW83440.1| hypothetical protein ZEAMMB73_211552 [Zea mays] Length = 653 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 409 QVVPHITDAIQGWIERVAAIPVDGKEGPPDVLIVD 513 QVVPHITD IQ WIERVA IPVDGKEGPPDV +++ Sbjct: 112 QVVPHITDEIQDWIERVAVIPVDGKEGPPDVCVIE 146 >ref|XP_002884917.1| EMB2742 [Arabidopsis lyrata subsp. lyrata] gi|297330757|gb|EFH61176.1| EMB2742 [Arabidopsis lyrata subsp. lyrata] Length = 591 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 409 QVVPHITDAIQGWIERVAAIPVDGKEGPPDVLIVD 513 QVVPH+TDAIQ WIERVA +PVDGKEGPPDV +++ Sbjct: 112 QVVPHVTDAIQEWIERVANVPVDGKEGPPDVCVIE 146