BLASTX nr result
ID: Atractylodes21_contig00014986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014986 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138151.1| PREDICTED: hypersensitive-induced response p... 77 1e-12 ref|XP_003609002.1| Hypersensitive-induced response protein [Med... 77 2e-12 ref|XP_003609001.1| Hypersensitive-induced response protein [Med... 77 2e-12 ref|XP_003609000.1| Hypersensitive-induced response protein [Med... 77 2e-12 ref|XP_003608997.1| Hypersensitive-induced response protein [Med... 77 2e-12 >ref|XP_004138151.1| PREDICTED: hypersensitive-induced response protein 1-like isoform 1 [Cucumis sativus] gi|449440760|ref|XP_004138152.1| PREDICTED: hypersensitive-induced response protein 1-like isoform 2 [Cucumis sativus] gi|449477307|ref|XP_004154987.1| PREDICTED: hypersensitive-induced response protein 1-like isoform 1 [Cucumis sativus] gi|449477311|ref|XP_004154988.1| PREDICTED: hypersensitive-induced response protein 1-like isoform 2 [Cucumis sativus] Length = 286 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGSATT 125 TMKEIGAASKS++VFIPHGPGAVRDVASQIRDGLLQG+AT+ Sbjct: 245 TMKEIGAASKSTSVFIPHGPGAVRDVASQIRDGLLQGAATS 285 >ref|XP_003609002.1| Hypersensitive-induced response protein [Medicago truncatula] gi|355510057|gb|AES91199.1| Hypersensitive-induced response protein [Medicago truncatula] Length = 270 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 116 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS Sbjct: 229 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 266 >ref|XP_003609001.1| Hypersensitive-induced response protein [Medicago truncatula] gi|355510056|gb|AES91198.1| Hypersensitive-induced response protein [Medicago truncatula] Length = 358 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 116 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS Sbjct: 317 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 354 >ref|XP_003609000.1| Hypersensitive-induced response protein [Medicago truncatula] gi|355510055|gb|AES91197.1| Hypersensitive-induced response protein [Medicago truncatula] Length = 346 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 116 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS Sbjct: 305 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 342 >ref|XP_003608997.1| Hypersensitive-induced response protein [Medicago truncatula] gi|355510052|gb|AES91194.1| Hypersensitive-induced response protein [Medicago truncatula] Length = 299 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 116 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS Sbjct: 258 TMKEIGAASKSSAVFIPHGPGAVRDVASQIRDGLLQGS 295