BLASTX nr result
ID: Atractylodes21_contig00014637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014637 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY74340.1| putative HMG-CoA synthase 2 [Artemisia annua] 110 2e-22 gb|ACY74339.1| putative HMG-CoA synthase 1 [Artemisia annua] 107 8e-22 gb|ACV65039.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [S... 101 6e-20 gb|ABD57974.2| hydroxy-methylglutaryl CoA synthase [Arnebia euch... 100 9e-20 ref|NP_001234846.1| 3-hydroxy-3-methylglutaryl coenzyme A syntha... 100 9e-20 >gb|ACY74340.1| putative HMG-CoA synthase 2 [Artemisia annua] Length = 438 Score = 110 bits (274), Expect = 2e-22 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = +3 Query: 3 PEKFVEVMQIMEHRYGGKDFVTSKDTTLLAPGTYYLTEVDSKYRRFYEKKTTKLANGH 176 PEKFVE+M +MEHRYGGKDFVTSKDT+ LAPGTYYLTEVDSKYRRFY KKTT++ANGH Sbjct: 381 PEKFVELMHLMEHRYGGKDFVTSKDTSHLAPGTYYLTEVDSKYRRFYAKKTTEVANGH 438 >gb|ACY74339.1| putative HMG-CoA synthase 1 [Artemisia annua] Length = 458 Score = 107 bits (268), Expect = 8e-22 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = +3 Query: 3 PEKFVEVMQIMEHRYGGKDFVTSKDTTLLAPGTYYLTEVDSKYRRFYEKKTTKLANG 173 PEKFVE+M++MEHRYGGKDFVTSKDTTLLAP TYYLTEVDSKYRR+Y KKT++LANG Sbjct: 401 PEKFVELMKVMEHRYGGKDFVTSKDTTLLAPDTYYLTEVDSKYRRYYAKKTSELANG 457 >gb|ACV65039.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Salvia miltiorrhiza] Length = 460 Score = 101 bits (252), Expect = 6e-20 Identities = 48/61 (78%), Positives = 53/61 (86%), Gaps = 3/61 (4%) Frame = +3 Query: 3 PEKFVEVMQIMEHRYGGKDFVTSKDTTLLAPGTYYLTEVDSKYRRFYEKKTT---KLANG 173 PEKFVE+MQ+MEHRYGGKDF+TSKD +LLAPGTYYLTEVDSKYRRFY KK +ANG Sbjct: 400 PEKFVELMQLMEHRYGGKDFITSKDCSLLAPGTYYLTEVDSKYRRFYAKKAIANGTVANG 459 Query: 174 H 176 H Sbjct: 460 H 460 >gb|ABD57974.2| hydroxy-methylglutaryl CoA synthase [Arnebia euchroma] Length = 317 Score = 100 bits (250), Expect = 9e-20 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 3/60 (5%) Frame = +3 Query: 6 EKFVEVMQIMEHRYGGKDFVTSKDTTLLAPGTYYLTEVDSKYRRFYEKKTT---KLANGH 176 +KFV++MQ+MEHRYGGKDFVTSKD +LLAPGTYYLTEVDSKYRRFY KK + KLANGH Sbjct: 258 KKFVDLMQLMEHRYGGKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYSKKESENGKLANGH 317 >ref|NP_001234846.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Solanum lycopersicum] gi|160966277|gb|ABX55778.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Solanum lycopersicum] Length = 462 Score = 100 bits (250), Expect = 9e-20 Identities = 48/60 (80%), Positives = 52/60 (86%), Gaps = 2/60 (3%) Frame = +3 Query: 3 PEKFVEVMQIMEHRYGGKDFVTSKDTTLLAPGTYYLTEVDSKYRRFYEKKTTK--LANGH 176 PE F+E M+IMEHRYGGKDFVTSKD +LLAPGTYYLTEVDSKYRRFY KK + LANGH Sbjct: 403 PENFIETMKIMEHRYGGKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKCAENGLANGH 462