BLASTX nr result
ID: Atractylodes21_contig00014395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014395 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324971.1| predicted protein [Populus trichocarpa] gi|2... 92 3e-17 ref|XP_002515582.1| conserved hypothetical protein [Ricinus comm... 91 1e-16 ref|XP_002331732.1| predicted protein [Populus trichocarpa] gi|2... 89 3e-16 ref|XP_002281346.2| PREDICTED: protein VERNALIZATION INSENSITIVE... 87 1e-15 emb|CBI28103.3| unnamed protein product [Vitis vinifera] 87 1e-15 >ref|XP_002324971.1| predicted protein [Populus trichocarpa] gi|222866405|gb|EEF03536.1| predicted protein [Populus trichocarpa] Length = 717 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +1 Query: 1 RRILISNLQPCTEYSFRIVSYTETGDLGHSEAKCFTESVEILHKNP 138 RRILISNLQPCTEY+FRIVSYTE GDLGHSEAKCFT+S+EI+HKNP Sbjct: 383 RRILISNLQPCTEYTFRIVSYTEAGDLGHSEAKCFTKSIEIIHKNP 428 >ref|XP_002515582.1| conserved hypothetical protein [Ricinus communis] gi|223545526|gb|EEF47031.1| conserved hypothetical protein [Ricinus communis] Length = 725 Score = 90.9 bits (224), Expect = 1e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 1 RRILISNLQPCTEYSFRIVSYTETGDLGHSEAKCFTESVEILHKNP 138 RRILISNLQPCTEY+FRIVSYTE GD GHSEAKCFT+S+EI+HKNP Sbjct: 394 RRILISNLQPCTEYTFRIVSYTEAGDFGHSEAKCFTKSIEIIHKNP 439 >ref|XP_002331732.1| predicted protein [Populus trichocarpa] gi|222874135|gb|EEF11266.1| predicted protein [Populus trichocarpa] Length = 612 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 1 RRILISNLQPCTEYSFRIVSYTETGDLGHSEAKCFTESVEILHKNP 138 RRILISNLQPCTEY+FRIVSYTE GDLGHSEAKCFT+S+EI+ KNP Sbjct: 279 RRILISNLQPCTEYTFRIVSYTEAGDLGHSEAKCFTKSIEIIQKNP 324 >ref|XP_002281346.2| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Vitis vinifera] Length = 711 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/55 (69%), Positives = 49/55 (89%) Frame = +1 Query: 1 RRILISNLQPCTEYSFRIVSYTETGDLGHSEAKCFTESVEILHKNPGDVMVPHDE 165 RR+LISNLQPCTEYSFRI+SYT++GDLGHSEAKCFT+SVEI++K+ ++ + E Sbjct: 390 RRVLISNLQPCTEYSFRIISYTKSGDLGHSEAKCFTKSVEIIYKSSNSTIMQNGE 444 >emb|CBI28103.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/55 (69%), Positives = 49/55 (89%) Frame = +1 Query: 1 RRILISNLQPCTEYSFRIVSYTETGDLGHSEAKCFTESVEILHKNPGDVMVPHDE 165 RR+LISNLQPCTEYSFRI+SYT++GDLGHSEAKCFT+SVEI++K+ ++ + E Sbjct: 320 RRVLISNLQPCTEYSFRIISYTKSGDLGHSEAKCFTKSVEIIYKSSNSTIMQNGE 374