BLASTX nr result
ID: Atractylodes21_contig00014388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014388 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADY68781.1| 14-3-3-like protein [Gossypium raimondii] 69 5e-13 gb|ADY68779.1| 14-3-3-like protein [Gossypium barbadense] gi|324... 69 5e-13 gb|ADY68778.1| 14-3-3-like protein [Gossypium barbadense] 69 5e-13 gb|ABD63905.1| 14-3-3-like protein [Gossypium hirsutum] gi|32498... 69 5e-13 gb|AEN70731.1| 14-3-3-like protein, partial [Gossypium tomentosu... 69 5e-13 >gb|ADY68781.1| 14-3-3-like protein [Gossypium raimondii] Length = 253 Score = 69.3 bits (168), Expect(2) = 5e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 2 IEQKEEGKGHEQNVKRIKDYRKRVEDGLTIICNDILLIIDFPLAP 136 IEQKEE KG+EQNVKRIKDYR+RVED L+ ICNDIL +ID L P Sbjct: 67 IEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIP 111 Score = 29.6 bits (65), Expect(2) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 129 LLPSSKAGESAVFYHKM 179 L+PSS GES VFY+KM Sbjct: 109 LIPSSSTGESTVFYYKM 125 >gb|ADY68779.1| 14-3-3-like protein [Gossypium barbadense] gi|324983999|gb|ADY68782.1| 14-3-3-like protein [Gossypium hirsutum] Length = 253 Score = 69.3 bits (168), Expect(2) = 5e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 2 IEQKEEGKGHEQNVKRIKDYRKRVEDGLTIICNDILLIIDFPLAP 136 IEQKEE KG+EQNVKRIKDYR+RVED L+ ICNDIL +ID L P Sbjct: 67 IEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIP 111 Score = 29.6 bits (65), Expect(2) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 129 LLPSSKAGESAVFYHKM 179 L+PSS GES VFY+KM Sbjct: 109 LIPSSSTGESTVFYYKM 125 >gb|ADY68778.1| 14-3-3-like protein [Gossypium barbadense] Length = 253 Score = 69.3 bits (168), Expect(2) = 5e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 2 IEQKEEGKGHEQNVKRIKDYRKRVEDGLTIICNDILLIIDFPLAP 136 IEQKEE KG+EQNVKRIKDYR+RVED L+ ICNDIL +ID L P Sbjct: 67 IEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIP 111 Score = 29.6 bits (65), Expect(2) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 129 LLPSSKAGESAVFYHKM 179 L+PSS GES VFY+KM Sbjct: 109 LIPSSSTGESTVFYYKM 125 >gb|ABD63905.1| 14-3-3-like protein [Gossypium hirsutum] gi|324983995|gb|ADY68780.1| 14-3-3-like protein [Gossypium herbaceum subsp. africanum] gi|324984001|gb|ADY68783.1| 14-3-3-like protein [Gossypium hirsutum] Length = 253 Score = 69.3 bits (168), Expect(2) = 5e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 2 IEQKEEGKGHEQNVKRIKDYRKRVEDGLTIICNDILLIIDFPLAP 136 IEQKEE KG+EQNVKRIKDYR+RVED L+ ICNDIL +ID L P Sbjct: 67 IEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIP 111 Score = 29.6 bits (65), Expect(2) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 129 LLPSSKAGESAVFYHKM 179 L+PSS GES VFY+KM Sbjct: 109 LIPSSSTGESTVFYYKM 125 >gb|AEN70731.1| 14-3-3-like protein, partial [Gossypium tomentosum] gi|345103823|gb|AEN70733.1| 14-3-3-like protein, partial [Gossypium barbadense var. brasiliense] gi|345103827|gb|AEN70735.1| 14-3-3-like protein, partial [Gossypium barbadense var. peruvianum] Length = 252 Score = 69.3 bits (168), Expect(2) = 5e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 2 IEQKEEGKGHEQNVKRIKDYRKRVEDGLTIICNDILLIIDFPLAP 136 IEQKEE KG+EQNVKRIKDYR+RVED L+ ICNDIL +ID L P Sbjct: 67 IEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSVIDKHLIP 111 Score = 29.6 bits (65), Expect(2) = 5e-13 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 Query: 129 LLPSSKAGESAVFYHKM 179 L+PSS GES VFY+KM Sbjct: 109 LIPSSSTGESTVFYYKM 125