BLASTX nr result
ID: Atractylodes21_contig00014381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014381 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL06913.1| AT4g37930/F20D10_50 [Arabidopsis thaliana] 68 7e-10 ref|NP_195506.1| glycine hydroxymethyltransferase [Arabidopsis t... 68 7e-10 ref|XP_002866922.1| hypothetical protein ARALYDRAFT_490821 [Arab... 67 2e-09 dbj|BAJ33788.1| unnamed protein product [Thellungiella halophila] 64 1e-08 ref|XP_002262872.2| PREDICTED: serine hydroxymethyltransferase, ... 64 2e-08 >gb|AAL06913.1| AT4g37930/F20D10_50 [Arabidopsis thaliana] Length = 517 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 2 SNSSKFA*TLIERGYELIYGGTENYLVLVNLKPKGIDGS 118 SNS+KFA TL+ERGYEL+ GGT+N+LVLVNLKPKGIDGS Sbjct: 361 SNSAKFAQTLMERGYELVSGGTDNHLVLVNLKPKGIDGS 399 >ref|NP_195506.1| glycine hydroxymethyltransferase [Arabidopsis thaliana] gi|51701455|sp|Q9SZJ5.1|GLYM_ARATH RecName: Full=Serine hydroxymethyltransferase, mitochondrial; Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; AltName: Full=Serine methylase; Flags: Precursor gi|16226393|gb|AAL16156.1|AF428388_1 AT4g37930/F20D10_50 [Arabidopsis thaliana] gi|4467099|emb|CAB37533.1| glycine hydroxymethyltransferase like protein [Arabidopsis thaliana] gi|6899945|emb|CAB71289.1| serine hydroxymethyl transferase [Arabidopsis thaliana] gi|7270776|emb|CAB80458.1| glycine hydroxymethyltransferase like protein [Arabidopsis thaliana] gi|16323083|gb|AAL15276.1| AT4g37930/F20D10_50 [Arabidopsis thaliana] gi|17979462|gb|AAL50068.1| AT4g37930/F20D10_50 [Arabidopsis thaliana] gi|30102486|gb|AAP21161.1| At4g37930/F20D10_50 [Arabidopsis thaliana] gi|332661455|gb|AEE86855.1| glycine hydroxymethyltransferase [Arabidopsis thaliana] Length = 517 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 2 SNSSKFA*TLIERGYELIYGGTENYLVLVNLKPKGIDGS 118 SNS+KFA TL+ERGYEL+ GGT+N+LVLVNLKPKGIDGS Sbjct: 361 SNSAKFAQTLMERGYELVSGGTDNHLVLVNLKPKGIDGS 399 >ref|XP_002866922.1| hypothetical protein ARALYDRAFT_490821 [Arabidopsis lyrata subsp. lyrata] gi|297312758|gb|EFH43181.1| hypothetical protein ARALYDRAFT_490821 [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +2 Query: 2 SNSSKFA*TLIERGYELIYGGTENYLVLVNLKPKGIDGS 118 SNS+KFA TL+E+GYEL+ GGT+N+LVLVNLKPKGIDGS Sbjct: 361 SNSAKFAQTLMEKGYELVSGGTDNHLVLVNLKPKGIDGS 399 >dbj|BAJ33788.1| unnamed protein product [Thellungiella halophila] Length = 518 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +2 Query: 2 SNSSKFA*TLIERGYELIYGGTENYLVLVNLKPKGIDGS 118 SNS+KFA TL+E+GYEL+ GGT+N+LVLVNLK KGIDGS Sbjct: 362 SNSAKFAQTLMEKGYELVSGGTDNHLVLVNLKSKGIDGS 400 >ref|XP_002262872.2| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like [Vitis vinifera] gi|297736687|emb|CBI25704.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 SNSSKFA*TLIERGYELIYGGTENYLVLVNLKPKGIDGS 118 SN SKFA TLI++GYEL+ GGTEN+LVLVNLK KGIDGS Sbjct: 362 SNCSKFAETLIKKGYELVSGGTENHLVLVNLKNKGIDGS 400