BLASTX nr result
ID: Atractylodes21_contig00014244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014244 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528624.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002528624.1| conserved hypothetical protein [Ricinus communis] gi|223531969|gb|EEF33782.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/57 (49%), Positives = 34/57 (59%) Frame = +1 Query: 211 MAKXXXXXXXXXXXHCRPTPYPMLTCGQNVSGDLDGKKSSIVMPIKDWEDITCSVCM 381 MAK CR PYP+ +C ++VS DL KKSS + KDWED+TCSVCM Sbjct: 1 MAKGSRARRGTASRQCRLAPYPLPSCDRDVSEDLYLKKSSKMFDKKDWEDVTCSVCM 57