BLASTX nr result
ID: Atractylodes21_contig00014139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00014139 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC75926.1| cysteine protease-4 [Helianthus annuus] 89 3e-16 dbj|BAC10906.1| cysteine proteinase [Zinnia elegans] 85 5e-15 dbj|BAF43527.1| cysteine proteinase [Zinnia elegans] 85 5e-15 ref|XP_002510720.1| cysteine protease, putative [Ricinus communi... 84 2e-14 ref|XP_002514413.1| cysteine protease, putative [Ricinus communi... 81 1e-13 >dbj|BAC75926.1| cysteine protease-4 [Helianthus annuus] Length = 352 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 3 VRNSWGPKWGEKGYIRMKRKTGKPQGMCGLYMMASYPTKK 122 VRNSWGPKWGEKGYIRMKRKTGKP GMCGLYMMASYPTK+ Sbjct: 312 VRNSWGPKWGEKGYIRMKRKTGKPHGMCGLYMMASYPTKQ 351 >dbj|BAC10906.1| cysteine proteinase [Zinnia elegans] Length = 352 Score = 85.1 bits (209), Expect = 5e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 VRNSWGPKWGEKGYIRMKRKTGKPQGMCGLYMMASYPTKK 122 VRNSWGPKWGEKGYIRMKR +GKP GMCGLYMMASYPTK+ Sbjct: 312 VRNSWGPKWGEKGYIRMKRGSGKPHGMCGLYMMASYPTKQ 351 >dbj|BAF43527.1| cysteine proteinase [Zinnia elegans] Length = 352 Score = 85.1 bits (209), Expect = 5e-15 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 3 VRNSWGPKWGEKGYIRMKRKTGKPQGMCGLYMMASYPTKK 122 VRNSWGPKWGEKGYIRMKR +GKP GMCGLYMMASYPTK+ Sbjct: 312 VRNSWGPKWGEKGYIRMKRGSGKPHGMCGLYMMASYPTKQ 351 >ref|XP_002510720.1| cysteine protease, putative [Ricinus communis] gi|223551421|gb|EEF52907.1| cysteine protease, putative [Ricinus communis] Length = 349 Score = 83.6 bits (205), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 3 VRNSWGPKWGEKGYIRMKRKTGKPQGMCGLYMMASYPTKK 122 V+NSWGPKWGEKGYIRMKRKT KP+G+CG+Y MASYPTKK Sbjct: 309 VKNSWGPKWGEKGYIRMKRKTSKPEGICGIYKMASYPTKK 348 >ref|XP_002514413.1| cysteine protease, putative [Ricinus communis] gi|223546510|gb|EEF48009.1| cysteine protease, putative [Ricinus communis] Length = 324 Score = 80.9 bits (198), Expect = 1e-13 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 VRNSWGPKWGEKGYIRMKRKTGKPQGMCGLYMMASYPTKK 122 V+NSWGPKWGEKGYIRMKR TGKP+G+CG+ MASYPTKK Sbjct: 284 VKNSWGPKWGEKGYIRMKRNTGKPEGLCGINKMASYPTKK 323