BLASTX nr result
ID: Atractylodes21_contig00013661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00013661 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ94906.1| predicted protein [Hordeum vulgare subsp. vulgare] 77 2e-12 ref|XP_003568800.1| PREDICTED: bifunctional protein tilS/hprT-li... 75 6e-12 dbj|BAJ99656.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 6e-12 ref|XP_002439390.1| hypothetical protein SORBIDRAFT_09g005630 [S... 75 6e-12 ref|NP_001147566.1| bifunctional protein tilS/hprT [Zea mays] gi... 75 6e-12 >dbj|BAJ94906.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 195 Score = 76.6 bits (187), Expect = 2e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 321 KFYSGFECPDSFVVGYGLDFNERYRNLPYIGVLKPEMY 208 KFY GFECPDSFVVGYG+D+ E YRNLPY+GVLKPEMY Sbjct: 152 KFYRGFECPDSFVVGYGMDYAELYRNLPYVGVLKPEMY 189 >ref|XP_003568800.1| PREDICTED: bifunctional protein tilS/hprT-like [Brachypodium distachyon] Length = 195 Score = 75.1 bits (183), Expect = 6e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 321 KFYSGFECPDSFVVGYGLDFNERYRNLPYIGVLKPEMY 208 KFY GFECPDSFVVGYG+D+ E YRNLPY+GVLKPE+Y Sbjct: 152 KFYRGFECPDSFVVGYGMDYAELYRNLPYVGVLKPEIY 189 >dbj|BAJ99656.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 195 Score = 75.1 bits (183), Expect = 6e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 321 KFYSGFECPDSFVVGYGLDFNERYRNLPYIGVLKPEMY 208 KFY GF+CPDSFVVGYG+D+ E YRNLPY+GVLKPEMY Sbjct: 152 KFYRGFKCPDSFVVGYGMDYAELYRNLPYVGVLKPEMY 189 >ref|XP_002439390.1| hypothetical protein SORBIDRAFT_09g005630 [Sorghum bicolor] gi|241944675|gb|EES17820.1| hypothetical protein SORBIDRAFT_09g005630 [Sorghum bicolor] Length = 193 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 321 KFYSGFECPDSFVVGYGLDFNERYRNLPYIGVLKPEMY 208 KFY GFECPD FVVGYGLD+ E YRNLPY+GVLKPEMY Sbjct: 150 KFYRGFECPDYFVVGYGLDYAELYRNLPYVGVLKPEMY 187 >ref|NP_001147566.1| bifunctional protein tilS/hprT [Zea mays] gi|224034179|gb|ACN36165.1| unknown [Zea mays] gi|413944650|gb|AFW77299.1| bifunctional protein tilS/hprT [Zea mays] Length = 266 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 321 KFYSGFECPDSFVVGYGLDFNERYRNLPYIGVLKPEMY 208 KFY GFECPD FVVGYGLD+ E YRNLPY+GVLKPEMY Sbjct: 223 KFYRGFECPDYFVVGYGLDYAELYRNLPYVGVLKPEMY 260