BLASTX nr result
ID: Atractylodes21_contig00013503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00013503 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268537.2| PREDICTED: nucleobase-ascorbate transporter ... 69 5e-10 ref|XP_002527465.1| purine permease, putative [Ricinus communis]... 69 5e-10 ref|XP_004139469.1| PREDICTED: nucleobase-ascorbate transporter ... 67 2e-09 ref|XP_003539808.1| PREDICTED: nucleobase-ascorbate transporter ... 65 8e-09 ref|XP_003551071.1| PREDICTED: nucleobase-ascorbate transporter ... 64 1e-08 >ref|XP_002268537.2| PREDICTED: nucleobase-ascorbate transporter 12-like [Vitis vinifera] Length = 714 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 75 SVSIEPGFLIDDEFVSRHSHMKYEIRDTPGLVPVGFCGFQHYIS 206 +V + P + DD FV+RHSHMKYE+RDTPGLVP+G GFQHY+S Sbjct: 155 AVDVLPQTVDDDGFVARHSHMKYELRDTPGLVPIGLYGFQHYVS 198 >ref|XP_002527465.1| purine permease, putative [Ricinus communis] gi|223533200|gb|EEF34957.1| purine permease, putative [Ricinus communis] Length = 697 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 78 VSIEPGFLIDDEFVSRHSHMKYEIRDTPGLVPVGFCGFQHYIS 206 V + P L DD FV RHSHMKYE+RDTPGLVP+G GFQHY+S Sbjct: 156 VDVLPQTLEDDGFVGRHSHMKYELRDTPGLVPIGLYGFQHYLS 198 >ref|XP_004139469.1| PREDICTED: nucleobase-ascorbate transporter 12-like [Cucumis sativus] gi|449526130|ref|XP_004170067.1| PREDICTED: nucleobase-ascorbate transporter 12-like [Cucumis sativus] Length = 701 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 105 DDEFVSRHSHMKYEIRDTPGLVPVGFCGFQHYIS 206 DD FV+RHSHMKYE+RDTPGLVP+G GFQHYIS Sbjct: 152 DDGFVARHSHMKYELRDTPGLVPIGLYGFQHYIS 185 >ref|XP_003539808.1| PREDICTED: nucleobase-ascorbate transporter 12-like [Glycine max] Length = 683 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 105 DDEFVSRHSHMKYEIRDTPGLVPVGFCGFQHYIS 206 DDEFVSRHSHMKYE+RD+PGLVP+G G QHY S Sbjct: 134 DDEFVSRHSHMKYELRDSPGLVPIGVYGIQHYFS 167 >ref|XP_003551071.1| PREDICTED: nucleobase-ascorbate transporter 12-like [Glycine max] Length = 694 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 105 DDEFVSRHSHMKYEIRDTPGLVPVGFCGFQHYIS 206 DD+FVSRHSHMKYE+RD+PGLVP+G G QHY+S Sbjct: 145 DDDFVSRHSHMKYELRDSPGLVPIGVYGIQHYLS 178