BLASTX nr result
ID: Atractylodes21_contig00012430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012430 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN58746.1| C-repeat binding factor [Ageratina adenophora] 77 1e-12 gb|ADE62311.1| dehydration-responsive element-binding protein 1A... 75 4e-12 gb|ABI95805.1| C-repeat binding factor [Ageratina adenophora] 75 5e-12 gb|ACJ63286.1| C-repeat binding factor 1 [Ammopiptanthus mongoli... 70 1e-10 ref|XP_002318846.1| AP2/ERF domain-containing transcription fact... 70 2e-10 >gb|ABN58746.1| C-repeat binding factor [Ageratina adenophora] Length = 219 Score = 77.0 bits (188), Expect = 1e-12 Identities = 40/70 (57%), Positives = 48/70 (68%), Gaps = 8/70 (11%) Frame = +1 Query: 64 PYMNAFLGLSLDH--------TFDCRSSTTVVEGEVMLAAQTPKKRAGRKKFRETRHPVY 219 P+ + LS D+ T D + T+ + EVMLA++ PKKRAGRKKFRETRHPVY Sbjct: 6 PFNTPYTSLSADNIPTTESSSTSDYSTGTSFSDEEVMLASKNPKKRAGRKKFRETRHPVY 65 Query: 220 RGVRRRDSGK 249 RGVRRRDSGK Sbjct: 66 RGVRRRDSGK 75 >gb|ADE62311.1| dehydration-responsive element-binding protein 1A [Ageratina adenophora] Length = 219 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 103 TFDCRSSTTVVEGEVMLAAQTPKKRAGRKKFRETRHPVYRGVRRRDSGK 249 T D + T+ + EVMLA++ PKKRAGRKKFRETRHPVYRGVRRRDSGK Sbjct: 27 TSDYSTGTSFSDEEVMLASKNPKKRAGRKKFRETRHPVYRGVRRRDSGK 75 >gb|ABI95805.1| C-repeat binding factor [Ageratina adenophora] Length = 219 Score = 75.1 bits (183), Expect = 5e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 103 TFDCRSSTTVVEGEVMLAAQTPKKRAGRKKFRETRHPVYRGVRRRDSGK 249 T D + T+ + EVMLA++ PKKRAGRKKFRETRHP+YRGVRRRDSGK Sbjct: 27 TSDYSTGTSFSDEEVMLASKNPKKRAGRKKFRETRHPIYRGVRRRDSGK 75 >gb|ACJ63286.1| C-repeat binding factor 1 [Ammopiptanthus mongolicus] Length = 221 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +1 Query: 118 SSTTVVEGEVMLAAQTPKKRAGRKKFRETRHPVYRGVRRRDSGK 249 S V EV+LAA PKKRAGRKKFRETRHPVYRGVRRR+SGK Sbjct: 30 SRPAAVSDEVLLAASHPKKRAGRKKFRETRHPVYRGVRRRNSGK 73 >ref|XP_002318846.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|222859519|gb|EEE97066.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 255 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 142 EVMLAAQTPKKRAGRKKFRETRHPVYRGVRRRDSGK 249 EVMLA++ PKKRAGRKKFRETRHPVYRGVRRR+SGK Sbjct: 62 EVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGK 97