BLASTX nr result
ID: Atractylodes21_contig00012290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012290 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA92325.1| geraniol-responsible factor 15 [Matricaria chamo... 91 7e-17 gb|ADU20406.1| alpha-mannosidase [Capsicum annuum] 89 4e-16 ref|XP_003624502.1| Lysosomal alpha-mannosidase [Medicago trunca... 86 2e-15 ref|NP_001234851.1| alpha-mannosidase precursor [Solanum lycoper... 85 7e-15 gb|ABY83271.1| alpha-mannosidase [Solanum lycopersicum] 85 7e-15 >dbj|BAA92325.1| geraniol-responsible factor 15 [Matricaria chamomilla] Length = 76 Score = 91.3 bits (225), Expect = 7e-17 Identities = 46/59 (77%), Positives = 50/59 (84%), Gaps = 2/59 (3%) Frame = -1 Query: 398 MSLSANQGREEMEKKRLVWKVEN--DEPTTPQRGGPVDPQKLIVELAPMEIRTFILTLA 228 MSLSANQGR EMEKKRLVWK E D+ T P RGGPVDP KL+VELAPMEIRTFILT++ Sbjct: 1 MSLSANQGRVEMEKKRLVWKAEGSKDDKTAPPRGGPVDPLKLVVELAPMEIRTFILTVS 59 >gb|ADU20406.1| alpha-mannosidase [Capsicum annuum] Length = 1030 Score = 89.0 bits (219), Expect = 4e-16 Identities = 46/70 (65%), Positives = 53/70 (75%), Gaps = 2/70 (2%) Frame = -1 Query: 419 KITTVSEMSLSANQGREEMEKKRLVWKVE--NDEPTTPQRGGPVDPQKLIVELAPMEIRT 246 KI + EMSLSANQ REEMEKKRL WK E +D P RGGPVDP KL+VELAPMEIRT Sbjct: 951 KINKIKEMSLSANQEREEMEKKRLKWKAEAPSDSQDVP-RGGPVDPTKLVVELAPMEIRT 1009 Query: 245 FILTLAPNAP 216 F++ L ++P Sbjct: 1010 FVINLGQSSP 1019 >ref|XP_003624502.1| Lysosomal alpha-mannosidase [Medicago truncatula] gi|355499517|gb|AES80720.1| Lysosomal alpha-mannosidase [Medicago truncatula] Length = 1022 Score = 86.3 bits (212), Expect = 2e-15 Identities = 45/66 (68%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = -1 Query: 419 KITTVSEMSLSANQGREEMEKKRLVWKVE-NDEPTTPQRGGPVDPQKLIVELAPMEIRTF 243 KI+ V+EMSLSANQ R EMEKKRLVWKVE + E + RGGPVDP KL+VEL PMEIRTF Sbjct: 944 KISKVTEMSLSANQERAEMEKKRLVWKVEGSSEESKVVRGGPVDPAKLVVELVPMEIRTF 1003 Query: 242 ILTLAP 225 + P Sbjct: 1004 FVDFNP 1009 >ref|NP_001234851.1| alpha-mannosidase precursor [Solanum lycopersicum] gi|301176645|gb|ADK66339.1| alpha-mannosidase [Solanum lycopersicum] Length = 1028 Score = 84.7 bits (208), Expect = 7e-15 Identities = 44/71 (61%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -1 Query: 419 KITTVSEMSLSANQGREEMEKKRLVWKVENDEPTTP-QRGGPVDPQKLIVELAPMEIRTF 243 KI + EMSLSANQ R EMEKKRL WK E RGGPVDP KL+VELAPMEIRTF Sbjct: 951 KINKIREMSLSANQERVEMEKKRLKWKAEAPSDLRDVARGGPVDPTKLMVELAPMEIRTF 1010 Query: 242 ILTLAPNAPKG 210 ++ L+ + P+G Sbjct: 1011 VIDLSQSVPEG 1021 >gb|ABY83271.1| alpha-mannosidase [Solanum lycopersicum] Length = 1029 Score = 84.7 bits (208), Expect = 7e-15 Identities = 44/71 (61%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -1 Query: 419 KITTVSEMSLSANQGREEMEKKRLVWKVENDEPTTP-QRGGPVDPQKLIVELAPMEIRTF 243 KI + EMSLSANQ R EMEKKRL WK E RGGPVDP KL+VELAPMEIRTF Sbjct: 952 KINKIREMSLSANQERVEMEKKRLKWKAEAPSDLRDVARGGPVDPTKLMVELAPMEIRTF 1011 Query: 242 ILTLAPNAPKG 210 ++ L+ + P+G Sbjct: 1012 VIDLSQSVPEG 1022