BLASTX nr result
ID: Atractylodes21_contig00012207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00012207 (852 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA82994.1| protein kinase [Mesembryanthemum crystallinum] 61 4e-07 ref|XP_004167957.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-... 59 1e-06 ref|XP_004148228.1| PREDICTED: phototropin-1-like [Cucumis sativus] 59 1e-06 dbj|BAM36551.1| phototropin 1 [Fragaria x ananassa] 59 1e-06 gb|ACQ42250.1| blue light photoreceptor [Fragaria x ananassa] 59 1e-06 >emb|CAA82994.1| protein kinase [Mesembryanthemum crystallinum] Length = 572 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 149 VHRACAEREILDVLDHPFLPALYASFQINEFSDSACLIS 265 VHRACAEREILD+LDHPFLPALYASFQ N CLI+ Sbjct: 281 VHRACAEREILDMLDHPFLPALYASFQTN---THICLIT 316 >ref|XP_004167957.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-1-like, partial [Cucumis sativus] Length = 760 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 149 VHRACAEREILDVLDHPFLPALYASFQINEFSDSACLIS 265 VHRACAEREILD+LDHPFLPALYASFQ CLI+ Sbjct: 469 VHRACAEREILDMLDHPFLPALYASFQT---KTHVCLIT 504 >ref|XP_004148228.1| PREDICTED: phototropin-1-like [Cucumis sativus] Length = 952 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 149 VHRACAEREILDVLDHPFLPALYASFQINEFSDSACLIS 265 VHRACAEREILD+LDHPFLPALYASFQ CLI+ Sbjct: 661 VHRACAEREILDMLDHPFLPALYASFQT---KTHVCLIT 696 >dbj|BAM36551.1| phototropin 1 [Fragaria x ananassa] Length = 1028 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 149 VHRACAEREILDVLDHPFLPALYASFQINEFSDSACLIS 265 VHRACAEREILD+LDHPFLPALYASFQ CLI+ Sbjct: 738 VHRACAEREILDMLDHPFLPALYASFQT---KTHVCLIT 773 >gb|ACQ42250.1| blue light photoreceptor [Fragaria x ananassa] Length = 642 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +2 Query: 149 VHRACAEREILDVLDHPFLPALYASFQINEFSDSACLIS 265 VHRACAEREILD+LDHPFLPALYASFQ CLI+ Sbjct: 352 VHRACAEREILDMLDHPFLPALYASFQT---KTHVCLIT 387