BLASTX nr result
ID: Atractylodes21_contig00011591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00011591 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] 61 1e-07 gb|ACX85638.1| putative transposase [Cucumis melo] 59 5e-07 >emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] Length = 563 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +3 Query: 138 TLKPKSTRAPSMVWEHLTKVCDAKQN-PKAKCNYCGSQYACGSKKNGTSN 284 T K K T+ PS VW+H TKV + N P+A CNYCG YAC K+N TSN Sbjct: 26 TSKRKPTKPPSEVWDHFTKVKECDPNYPRATCNYCGIDYACHDKRNETSN 75 >gb|ACX85638.1| putative transposase [Cucumis melo] Length = 680 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +3 Query: 144 KPKSTRAPSMVWEHLTKV--CDAKQNPKAKCNYCGSQYACGSKKNGTSN 284 K K + PS VWEH KV CD K P+A C +CG+ YAC SK+NGT+N Sbjct: 21 KRKPVKPPSSVWEHFIKVEGCDPKY-PRAACKHCGASYACDSKRNGTTN 68