BLASTX nr result
ID: Atractylodes21_contig00011168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00011168 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66492.1| hypothetical protein VITISV_019851 [Vitis vinifera] 57 1e-06 >emb|CAN66492.1| hypothetical protein VITISV_019851 [Vitis vinifera] Length = 2294 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 14/76 (18%) Frame = +2 Query: 2 SLTAYKLTPTGYEWGRANKDTVS------------LPRNQPCSWHTDDYRANKDTIS--W 139 SLTAYKLTPTGYEWGR NKDT S +P N P ++ ++ K T+S + Sbjct: 2197 SLTAYKLTPTGYEWGRVNKDTGSNPHGYLPTHYEKIPDNGPWNY---NFMGVKHTVSMKY 2253 Query: 140 E*SRGLHGEYYNEDHR 187 G EYY+EDHR Sbjct: 2254 GIKLGTPREYYHEDHR 2269