BLASTX nr result
ID: Atractylodes21_contig00010946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010946 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533222.1| serine-threonine protein kinase, plant-type,... 56 3e-06 >ref|XP_002533222.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526965|gb|EEF29162.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 408 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = -3 Query: 180 SDQHIAVTMPPVQPMVSFSQILEETMERFLDDMARERPIRFSHKDINELTRNLSSFLGSG 1 S H+ + + P P+ S+I T+ERFL +ARE+P+RFS + I E+T N S LGSG Sbjct: 46 SSDHMTIRVEPEVPVNQDSRIQFATVERFLSKIAREKPVRFSPQQIEEITNNCSKILGSG 105