BLASTX nr result
ID: Atractylodes21_contig00010944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010944 (413 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier ... 68 9e-10 ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycin... 68 9e-10 ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis... 65 4e-09 gb|AFK35187.1| unknown [Lotus japonicus] gi|388509240|gb|AFK4268... 65 4e-09 ref|NP_001154779.1| small ubiquitin-related modifier 2 [Arabidop... 65 4e-09 >ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier 2-like [Glycine max] Length = 114 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 1 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGSGFL 102 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG FL Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKFL 103 >ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycine max] gi|255626371|gb|ACU13530.1| unknown [Glycine max] Length = 103 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 1 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGSGFL 102 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG FL Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKFL 103 >ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|75171511|sp|Q9FLP6.1|SUMO2_ARATH RecName: Full=Small ubiquitin-related modifier 2; Short=AtSUMO2 gi|9758113|dbj|BAB08585.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|19715611|gb|AAL91628.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21360423|gb|AAM47327.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21537401|gb|AAM61742.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|22652844|gb|AAN03846.1| small ubiquitin-like modifier 2 [Arabidopsis thaliana] gi|332009210|gb|AED96593.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Length = 103 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGS 93 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG+ Sbjct: 64 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGA 94 >gb|AFK35187.1| unknown [Lotus japonicus] gi|388509240|gb|AFK42686.1| unknown [Lotus japonicus] Length = 103 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGS 93 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG+ Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGA 100 >ref|NP_001154779.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|332009211|gb|AED96594.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Length = 116 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGS 93 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG+ Sbjct: 77 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGA 107