BLASTX nr result
ID: Atractylodes21_contig00010942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010942 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB29919.1| unknown [Solanum tuberosum] 67 2e-09 ref|XP_002531488.1| serine/arginine rich splicing factor, putati... 66 3e-09 gb|ACR36750.1| unknown [Zea mays] gi|414590933|tpg|DAA41504.1| T... 64 1e-08 gb|ACF88377.1| unknown [Zea mays] gi|414590930|tpg|DAA41501.1| T... 64 1e-08 ref|NP_001140562.1| uncharacterized protein LOC100272627 [Zea ma... 64 1e-08 >gb|ABB29919.1| unknown [Solanum tuberosum] Length = 258 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 3 DGRVVDGREMMVQFAKYGPNAEKIHKGRILEPVEKLK 113 DGRVVDGRE+MV+FAKYGPNAE+I KGRILEPV++ K Sbjct: 78 DGRVVDGREIMVRFAKYGPNAERIDKGRILEPVQRTK 114 >ref|XP_002531488.1| serine/arginine rich splicing factor, putative [Ricinus communis] gi|223528897|gb|EEF30895.1| serine/arginine rich splicing factor, putative [Ricinus communis] Length = 257 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 DGRVVDGREMMVQFAKYGPNAEKIHKGRILEPVEK 107 DGRVVDGRE+ VQFAKYGPNAE+IHKGRI+EPV + Sbjct: 78 DGRVVDGREITVQFAKYGPNAERIHKGRIIEPVPR 112 >gb|ACR36750.1| unknown [Zea mays] gi|414590933|tpg|DAA41504.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] gi|414590934|tpg|DAA41505.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] Length = 190 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 3 DGRVVDGREMMVQFAKYGPNAEKIHKGRILEPVEK 107 DGR+VDGRE+MVQFAKYGPNAE+I+KGRI+EPV + Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIMEPVPR 113 >gb|ACF88377.1| unknown [Zea mays] gi|414590930|tpg|DAA41501.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] gi|414590931|tpg|DAA41502.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] Length = 238 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 3 DGRVVDGREMMVQFAKYGPNAEKIHKGRILEPVEK 107 DGR+VDGRE+MVQFAKYGPNAE+I+KGRI+EPV + Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIMEPVPR 113 >ref|NP_001140562.1| uncharacterized protein LOC100272627 [Zea mays] gi|194699996|gb|ACF84082.1| unknown [Zea mays] gi|414590932|tpg|DAA41503.1| TPA: hypothetical protein ZEAMMB73_776046 [Zea mays] Length = 251 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 3 DGRVVDGREMMVQFAKYGPNAEKIHKGRILEPVEK 107 DGR+VDGRE+MVQFAKYGPNAE+I+KGRI+EPV + Sbjct: 79 DGRLVDGREIMVQFAKYGPNAERINKGRIMEPVPR 113