BLASTX nr result
ID: Atractylodes21_contig00010714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010714 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614642.1| Homocysteine s-methyltransferase [Medicago t... 82 6e-14 ref|XP_002315941.1| homocysteine s-methyltransferase [Populus tr... 81 1e-13 ref|XP_002282549.1| PREDICTED: homocysteine S-methyltransferase ... 79 4e-13 ref|NP_189219.1| homocysteine S-methyltransferase 1 [Arabidopsis... 78 9e-13 sp|A4ZGQ8.1|HMT1_BRAOT RecName: Full=Homocysteine S-methyltransf... 77 1e-12 >ref|XP_003614642.1| Homocysteine s-methyltransferase [Medicago truncatula] gi|355515977|gb|AES97600.1| Homocysteine s-methyltransferase [Medicago truncatula] Length = 326 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/78 (51%), Positives = 46/78 (58%) Frame = -2 Query: 234 AVGINCAPPQFVHSLVQKFKELTGKVIVVYPNSGETWDGVAKRWLVRYLILEIDVFEANY 55 AVGINCAPP F+ SL+ KFK+LT K IVVYPNSGE WDG+AK+WL Sbjct: 235 AVGINCAPPHFMESLIPKFKQLTNKAIVVYPNSGEVWDGIAKKWL--------------- 279 Query: 54 VFVLMMVFDAKPSKCFND 1 PSKCF+D Sbjct: 280 -----------PSKCFHD 286 >ref|XP_002315941.1| homocysteine s-methyltransferase [Populus trichocarpa] gi|222864981|gb|EEF02112.1| homocysteine s-methyltransferase [Populus trichocarpa] Length = 329 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 234 AVGINCAPPQFVHSLVQKFKELTGKVIVVYPNSGETWDGVAKRWL 100 AVGINCAPP F+ SL+ KFKELT K+IVVYPNSGE WDG AKRWL Sbjct: 236 AVGINCAPPHFIESLICKFKELTEKLIVVYPNSGEVWDGRAKRWL 280 >ref|XP_002282549.1| PREDICTED: homocysteine S-methyltransferase 1 [Vitis vinifera] gi|297737821|emb|CBI27022.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = -2 Query: 234 AVGINCAPPQFVHSLVQKFKELTGKVIVVYPNSGETWDGVAKRWL 100 AVGINCAPP F+ SL+ KFKELT K IVVYPNSGE WDG AKRWL Sbjct: 234 AVGINCAPPHFLESLICKFKELTEKPIVVYPNSGEVWDGRAKRWL 278 >ref|NP_189219.1| homocysteine S-methyltransferase 1 [Arabidopsis thaliana] gi|50400681|sp|Q9SDL7.1|HMT1_ARATH RecName: Full=Homocysteine S-methyltransferase 1; AltName: Full=S-methylmethionine:homocysteine methyltransferase 1; Short=AtHMT-1; Short=SMM:Hcy S-methyltransferase 1 gi|6685161|gb|AAF23821.1|AF219222_1 homocysteine S-methyltransferase AtHMT-1 [Arabidopsis thaliana] gi|9279594|dbj|BAB01052.1| homocysteine S-methyltransferase AtHMT-1 [Arabidopsis thaliana] gi|17473823|gb|AAL38339.1| homocysteine S-methyltransferase AtHMT-1 [Arabidopsis thaliana] gi|20148551|gb|AAM10166.1| homocysteine S-methyltransferase AtHMT-1 [Arabidopsis thaliana] gi|332643566|gb|AEE77087.1| homocysteine S-methyltransferase 1 [Arabidopsis thaliana] Length = 326 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 234 AVGINCAPPQFVHSLVQKFKELTGKVIVVYPNSGETWDGVAKRWL 100 AVGINCAPPQF+ +L++KF +LT K IVVYPNSGE WDG AK+WL Sbjct: 236 AVGINCAPPQFIENLIRKFAKLTKKAIVVYPNSGEVWDGKAKQWL 280 >sp|A4ZGQ8.1|HMT1_BRAOT RecName: Full=Homocysteine S-methyltransferase 1; Short=BoHMT1 gi|110468086|gb|ABG74913.1| homocysteine methyltransferase 1 [Brassica oleracea var. italica] Length = 326 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 234 AVGINCAPPQFVHSLVQKFKELTGKVIVVYPNSGETWDGVAKRWL 100 AVGINCAPPQF+ +L++KF +LT K IVVYPNSGE WDG AK+WL Sbjct: 236 AVGINCAPPQFMDNLIRKFSKLTQKAIVVYPNSGEVWDGKAKKWL 280