BLASTX nr result
ID: Atractylodes21_contig00010647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010647 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63349.1| hypothetical protein VITISV_024448 [Vitis vinifera] 66 3e-09 ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|NP_566222.1| pentatricopeptide repeat-containing protein [Ar... 63 2e-08 dbj|BAH19514.1| AT3G04130 [Arabidopsis thaliana] 63 2e-08 gb|AAF26800.1|AC016829_24 hypothetical protein [Arabidopsis thal... 63 2e-08 >emb|CAN63349.1| hypothetical protein VITISV_024448 [Vitis vinifera] Length = 324 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -2 Query: 152 FYNALIHTLERVVRLQEVLNVFEVEMPSFGVGTNTSTYNSMIAVF 18 FYNALIHTL R +L+E ++VFEVEMP GV NTSTYNSMIA+F Sbjct: 12 FYNALIHTLGRAGQLREAVHVFEVEMPKTGVPPNTSTYNSMIAMF 56 >ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -2 Query: 152 FYNALIHTLERVVRLQEVLNVFEVEMPSFGVGTNTSTYNSMIAVF 18 FYNALIHTL R +L+E + VFEVEMP GV NTSTYNSMIA+F Sbjct: 322 FYNALIHTLGRAGQLREAVRVFEVEMPKTGVPPNTSTYNSMIAMF 366 >ref|NP_566222.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|79312733|ref|NP_001030630.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546763|sp|Q9M8W9.2|PP211_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g04130, mitochondrial; Flags: Precursor gi|332640519|gb|AEE74040.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332640520|gb|AEE74041.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 508 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -2 Query: 152 FYNALIHTLERVVRLQEVLNVFEVEMPSFGVGTNTSTYNSMIAVF 18 FYN LIHTL R RL+E VF VEMP GV NTSTYNSMIA++ Sbjct: 331 FYNCLIHTLARAGRLEEAERVFRVEMPELGVSINTSTYNSMIAMY 375 >dbj|BAH19514.1| AT3G04130 [Arabidopsis thaliana] Length = 508 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -2 Query: 152 FYNALIHTLERVVRLQEVLNVFEVEMPSFGVGTNTSTYNSMIAVF 18 FYN LIHTL R RL+E VF VEMP GV NTSTYNSMIA++ Sbjct: 331 FYNCLIHTLARAGRLEEAERVFRVEMPELGVSINTSTYNSMIAMY 375 >gb|AAF26800.1|AC016829_24 hypothetical protein [Arabidopsis thaliana] Length = 572 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -2 Query: 152 FYNALIHTLERVVRLQEVLNVFEVEMPSFGVGTNTSTYNSMIAVF 18 FYN LIHTL R RL+E VF VEMP GV NTSTYNSMIA++ Sbjct: 395 FYNCLIHTLARAGRLEEAERVFRVEMPELGVSINTSTYNSMIAMY 439