BLASTX nr result
ID: Atractylodes21_contig00010607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010607 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139310.1| PREDICTED: uncharacterized protein LOC101221... 91 1e-16 ref|XP_003542679.1| PREDICTED: uncharacterized protein LOC100788... 90 2e-16 ref|XP_002524492.1| conserved hypothetical protein [Ricinus comm... 90 2e-16 ref|XP_002330521.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 gb|AAK25754.1|AF334834_1 putative chaperon P13.9 [Castanea sativa] 90 2e-16 >ref|XP_004139310.1| PREDICTED: uncharacterized protein LOC101221053 [Cucumis sativus] gi|449520705|ref|XP_004167374.1| PREDICTED: uncharacterized LOC101221053 [Cucumis sativus] Length = 137 Score = 90.5 bits (223), Expect = 1e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 255 DHFNGQFKAGGLCWLCRGKKEILCGNCNGAGFTGGFMSTAD 133 DHFNGQFKAGGLCWLCRGK++ILCG CNGAGF GGFMSTAD Sbjct: 96 DHFNGQFKAGGLCWLCRGKRDILCGGCNGAGFVGGFMSTAD 136 >ref|XP_003542679.1| PREDICTED: uncharacterized protein LOC100788324 [Glycine max] Length = 133 Score = 90.1 bits (222), Expect = 2e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 255 DHFNGQFKAGGLCWLCRGKKEILCGNCNGAGFTGGFMSTAD 133 DHFNGQFKAGGLCWLCRGKK+ILCG+CNGAGF GGFMST D Sbjct: 92 DHFNGQFKAGGLCWLCRGKKDILCGSCNGAGFLGGFMSTCD 132 >ref|XP_002524492.1| conserved hypothetical protein [Ricinus communis] gi|223536280|gb|EEF37932.1| conserved hypothetical protein [Ricinus communis] Length = 131 Score = 90.1 bits (222), Expect = 2e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 255 DHFNGQFKAGGLCWLCRGKKEILCGNCNGAGFTGGFMSTAD 133 DHFNGQFKAGGLCWLCRGK++ILCGNCNGAGF GGFMST D Sbjct: 90 DHFNGQFKAGGLCWLCRGKRDILCGNCNGAGFIGGFMSTFD 130 >ref|XP_002330521.1| predicted protein [Populus trichocarpa] gi|222872455|gb|EEF09586.1| predicted protein [Populus trichocarpa] Length = 109 Score = 90.1 bits (222), Expect = 2e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 255 DHFNGQFKAGGLCWLCRGKKEILCGNCNGAGFTGGFMSTADQ 130 DHFNGQFKAGGLCWLCRGK+EILCG+CNGAGF GGFMST D+ Sbjct: 68 DHFNGQFKAGGLCWLCRGKREILCGSCNGAGFLGGFMSTFDE 109 >gb|AAK25754.1|AF334834_1 putative chaperon P13.9 [Castanea sativa] Length = 131 Score = 90.1 bits (222), Expect = 2e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 255 DHFNGQFKAGGLCWLCRGKKEILCGNCNGAGFTGGFMSTADQ 130 DHFNGQFKAGGLCWLCRGK+EILCG+CNGAGF GGFMST D+ Sbjct: 90 DHFNGQFKAGGLCWLCRGKREILCGSCNGAGFLGGFMSTFDE 131