BLASTX nr result
ID: Atractylodes21_contig00010603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010603 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511357.1| transcription factor, putative [Ricinus comm... 59 8e-16 ref|NP_201113.2| transcription factor jumonji (jmjC) domain-cont... 50 2e-13 dbj|BAB10550.1| unnamed protein product [Arabidopsis thaliana] 50 2e-13 ref|XP_002866532.1| hypothetical protein ARALYDRAFT_332532 [Arab... 50 1e-12 ref|XP_003601228.1| JmjC domain-containing protein [Medicago tru... 59 7e-11 >ref|XP_002511357.1| transcription factor, putative [Ricinus communis] gi|223550472|gb|EEF51959.1| transcription factor, putative [Ricinus communis] Length = 462 Score = 58.5 bits (140), Expect(2) = 8e-16 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 76 VKEYPEYIAYTTPLFFCDDWMNLYLDHY 159 VKEYPEY+AY TPL FCDDW+N YLDHY Sbjct: 120 VKEYPEYVAYRTPLPFCDDWLNPYLDHY 147 Score = 49.7 bits (117), Expect(2) = 8e-16 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +3 Query: 162 HYHMHDDPDTYQKRDGINCSDYHFVYMGAKG 254 HY MH +PDTYQ+ + I SDY FVYMGAKG Sbjct: 146 HYRMHRNPDTYQENNEICSSDYRFVYMGAKG 176 >ref|NP_201113.2| transcription factor jumonji (jmjC) domain-containing protein [Arabidopsis thaliana] gi|51970546|dbj|BAD43965.1| unnamed protein product [Arabidopsis thaliana] gi|66792698|gb|AAY56451.1| At5g63080 [Arabidopsis thaliana] gi|332010314|gb|AED97697.1| transcription factor jumonji (jmjC) domain-containing protein [Arabidopsis thaliana] Length = 462 Score = 50.4 bits (119), Expect(2) = 2e-13 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +3 Query: 162 HYHMHDDPDTYQKRDGINCSDYHFVYMGAKG 254 +Y MH+D D++QK D I+CSDY FVYMG KG Sbjct: 141 NYQMHEDRDSFQKYDQISCSDYRFVYMGGKG 171 Score = 49.7 bits (117), Expect(2) = 2e-13 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +1 Query: 76 VKEYPEYIAYTTPLFFCDDWMNLYLDHY 159 VKEYP+Y AY TP F DDW+N+YLD+Y Sbjct: 115 VKEYPDYTAYQTPPLFSDDWLNVYLDNY 142 >dbj|BAB10550.1| unnamed protein product [Arabidopsis thaliana] Length = 440 Score = 50.4 bits (119), Expect(2) = 2e-13 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +3 Query: 162 HYHMHDDPDTYQKRDGINCSDYHFVYMGAKG 254 +Y MH+D D++QK D I+CSDY FVYMG KG Sbjct: 141 NYQMHEDRDSFQKYDQISCSDYRFVYMGGKG 171 Score = 49.7 bits (117), Expect(2) = 2e-13 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = +1 Query: 76 VKEYPEYIAYTTPLFFCDDWMNLYLDHY 159 VKEYP+Y AY TP F DDW+N+YLD+Y Sbjct: 115 VKEYPDYTAYQTPPLFSDDWLNVYLDNY 142 >ref|XP_002866532.1| hypothetical protein ARALYDRAFT_332532 [Arabidopsis lyrata subsp. lyrata] gi|297312367|gb|EFH42791.1| hypothetical protein ARALYDRAFT_332532 [Arabidopsis lyrata subsp. lyrata] Length = 458 Score = 49.7 bits (117), Expect(2) = 1e-12 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +1 Query: 76 VKEYPEYIAYTTPLFFCDDWMNLYLDHY 159 VKEYP+Y AY TP F DDW+N+YLD Y Sbjct: 111 VKEYPDYTAYQTPQLFSDDWLNIYLDSY 138 Score = 47.8 bits (112), Expect(2) = 1e-12 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = +3 Query: 165 YHMHDDPDTYQKRDGINCSDYHFVYMGAKG 254 Y MH+D D + K D I+CSDY FVYMG KG Sbjct: 138 YQMHEDRDNFHKYDQISCSDYRFVYMGGKG 167 >ref|XP_003601228.1| JmjC domain-containing protein [Medicago truncatula] gi|355490276|gb|AES71479.1| JmjC domain-containing protein [Medicago truncatula] Length = 525 Score = 58.9 bits (141), Expect(2) = 7e-11 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +1 Query: 76 VKEYPEYIAYTTPLFFCDDWMNLYLDHY 159 VKEYPEY+AY TP FFCDDW+NLYLD++ Sbjct: 136 VKEYPEYVAYITPTFFCDDWLNLYLDNF 163 Score = 32.7 bits (73), Expect(2) = 7e-11 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 162 HYHMHDDPDTYQKRDGINCSDYHFVYMGAKG 254 ++ M+ + Q+ I CSDY FVYMG KG Sbjct: 162 NFRMNTHSGSDQQNKEICCSDYRFVYMGVKG 192