BLASTX nr result
ID: Atractylodes21_contig00010444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010444 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539777.1| PREDICTED: ruBisCO large subunit-binding pro... 56 3e-06 ref|XP_003538152.1| PREDICTED: ruBisCO large subunit-binding pro... 56 3e-06 gb|AEO21430.1| putative rubisco subunit binding-protein alpha su... 56 3e-06 gb|AFK45390.1| unknown [Lotus japonicus] 55 6e-06 >ref|XP_003539777.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, chloroplastic-like [Glycine max] Length = 584 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 AGMVLTTQAIVVEKAKPKSPVAGAPQGLSV 92 AGMVLTTQAIVVEK KPK+PVAGAPQGL+V Sbjct: 555 AGMVLTTQAIVVEKPKPKAPVAGAPQGLTV 584 >ref|XP_003538152.1| PREDICTED: ruBisCO large subunit-binding protein subunit alpha, chloroplastic-like isoform 1 [Glycine max] Length = 584 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 AGMVLTTQAIVVEKAKPKSPVAGAPQGLSV 92 AGMVLTTQAIVVEK KPK+PVAGAPQGL+V Sbjct: 555 AGMVLTTQAIVVEKPKPKAPVAGAPQGLTV 584 >gb|AEO21430.1| putative rubisco subunit binding-protein alpha subunit [Glycine max] Length = 584 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 AGMVLTTQAIVVEKAKPKSPVAGAPQGLSV 92 AGMVLTTQAIVVEK KPK+PVAGAPQGL+V Sbjct: 555 AGMVLTTQAIVVEKPKPKAPVAGAPQGLTV 584 >gb|AFK45390.1| unknown [Lotus japonicus] Length = 587 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 AGMVLTTQAIVVEKAKPKSPVAGAPQGLSV 92 AGMVLTTQAIVVEKAKPK+PVA APQGL++ Sbjct: 558 AGMVLTTQAIVVEKAKPKAPVAAAPQGLTI 587