BLASTX nr result
ID: Atractylodes21_contig00010430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010430 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316920.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002329111.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002532684.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 dbj|BAF02554.1| hypothetical protein [Nicotiana benthamiana] 55 4e-06 ref|XP_002882949.1| hypothetical protein ARALYDRAFT_478998 [Arab... 55 6e-06 >ref|XP_002316920.1| predicted protein [Populus trichocarpa] gi|222859985|gb|EEE97532.1| predicted protein [Populus trichocarpa] Length = 109 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -3 Query: 272 RRRRASKEIVRRALTPPARRLSRRWFDFRPSPSRLSVMSMA 150 RR +A+KE++RRAL PP RRL+ RWF+FRP+PSRLS MSMA Sbjct: 69 RRHQANKELLRRALAPPNRRLTLRWFNFRPTPSRLSNMSMA 109 >ref|XP_002329111.1| predicted protein [Populus trichocarpa] gi|222869780|gb|EEF06911.1| predicted protein [Populus trichocarpa] Length = 108 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 272 RRRRASKEIVRRALTPPARRLSRRWFDFRPSPSRLSVMSMA 150 RR +A+ EI+RRAL PP RRL+ RWF+F+P+PSRLS MSMA Sbjct: 68 RRNQANTEILRRALAPPNRRLTLRWFNFQPTPSRLSNMSMA 108 >ref|XP_002532684.1| conserved hypothetical protein [Ricinus communis] gi|223527581|gb|EEF29697.1| conserved hypothetical protein [Ricinus communis] Length = 117 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 272 RRRRASKEIVRRALTPPARRLSRRWFDFRPSPSRLSVMSMA 150 R +AS+EI+RRAL PP R++S RW++FRP+PSRLS MSMA Sbjct: 77 RHHQASREILRRALAPPNRKMSLRWWNFRPTPSRLSNMSMA 117 >dbj|BAF02554.1| hypothetical protein [Nicotiana benthamiana] Length = 109 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 260 ASKEIVRRALTPPARRLSRRWFDFRPSPSRLSVMSMA 150 A+KEI++RALTPPA RL+ RW DF+P+PSRL MS A Sbjct: 73 ANKEIIKRALTPPAPRLTLRWLDFKPTPSRLCNMSAA 109 >ref|XP_002882949.1| hypothetical protein ARALYDRAFT_478998 [Arabidopsis lyrata subsp. lyrata] gi|297328789|gb|EFH59208.1| hypothetical protein ARALYDRAFT_478998 [Arabidopsis lyrata subsp. lyrata] Length = 106 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 287 EMVMPRRRRASKEIVRRALTPPARRLSRRWFDFRPSPSRLSVMS 156 E +M + S+E++RRALTPP RR++ RW +FRP+PSRL MS Sbjct: 61 ERLMQKASDGSREVLRRALTPPIRRMNLRWLNFRPTPSRLCKMS 104