BLASTX nr result
ID: Atractylodes21_contig00010201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010201 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277391.2| PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro... 119 2e-25 ref|XP_003544756.1| PREDICTED: 65-kDa microtubule-associated pro... 119 2e-25 ref|XP_003544755.1| PREDICTED: 65-kDa microtubule-associated pro... 119 2e-25 ref|XP_003519598.1| PREDICTED: 65-kDa microtubule-associated pro... 119 2e-25 emb|CBI26699.3| unnamed protein product [Vitis vinifera] 119 2e-25 >ref|XP_002277391.2| PREDICTED: LOW QUALITY PROTEIN: 65-kDa microtubule-associated protein 1-like [Vitis vinifera] Length = 582 Score = 119 bits (299), Expect = 2e-25 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = +2 Query: 2 RDKMLLQLEQECLNVYKRKVEQAAKSRAHLLQALADAKHELSTLLASLGEKTFVGIPEKT 181 RDKMLLQLEQECL+VYKRKV+QA KSRAHLLQALADA+ ELS LL++LGEK+FVGIP+KT Sbjct: 37 RDKMLLQLEQECLDVYKRKVDQAVKSRAHLLQALADAQLELSRLLSALGEKSFVGIPDKT 96 Query: 182 SGTIKEQLAAI 214 SGTIKEQLAAI Sbjct: 97 SGTIKEQLAAI 107 >ref|XP_003544756.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 2 [Glycine max] Length = 590 Score = 119 bits (299), Expect = 2e-25 Identities = 62/71 (87%), Positives = 67/71 (94%) Frame = +2 Query: 2 RDKMLLQLEQECLNVYKRKVEQAAKSRAHLLQALADAKHELSTLLASLGEKTFVGIPEKT 181 RDKMLLQLEQECL+VYKRKVEQAAKSRA LLQAL+DAK ELSTLL++LGEK+F GIPE T Sbjct: 45 RDKMLLQLEQECLDVYKRKVEQAAKSRAQLLQALSDAKLELSTLLSALGEKSFAGIPENT 104 Query: 182 SGTIKEQLAAI 214 SGTIKEQLAAI Sbjct: 105 SGTIKEQLAAI 115 >ref|XP_003544755.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 1 [Glycine max] Length = 582 Score = 119 bits (299), Expect = 2e-25 Identities = 62/71 (87%), Positives = 67/71 (94%) Frame = +2 Query: 2 RDKMLLQLEQECLNVYKRKVEQAAKSRAHLLQALADAKHELSTLLASLGEKTFVGIPEKT 181 RDKMLLQLEQECL+VYKRKVEQAAKSRA LLQAL+DAK ELSTLL++LGEK+F GIPE T Sbjct: 37 RDKMLLQLEQECLDVYKRKVEQAAKSRAQLLQALSDAKLELSTLLSALGEKSFAGIPENT 96 Query: 182 SGTIKEQLAAI 214 SGTIKEQLAAI Sbjct: 97 SGTIKEQLAAI 107 >ref|XP_003519598.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Glycine max] Length = 582 Score = 119 bits (299), Expect = 2e-25 Identities = 62/71 (87%), Positives = 67/71 (94%) Frame = +2 Query: 2 RDKMLLQLEQECLNVYKRKVEQAAKSRAHLLQALADAKHELSTLLASLGEKTFVGIPEKT 181 RDKMLLQLEQECL+VYKRKVEQAAKSRA LLQAL+DAK ELSTLL++LGEK+F GIPE T Sbjct: 37 RDKMLLQLEQECLDVYKRKVEQAAKSRAQLLQALSDAKLELSTLLSALGEKSFAGIPENT 96 Query: 182 SGTIKEQLAAI 214 SGTIKEQLAAI Sbjct: 97 SGTIKEQLAAI 107 >emb|CBI26699.3| unnamed protein product [Vitis vinifera] Length = 465 Score = 119 bits (299), Expect = 2e-25 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = +2 Query: 2 RDKMLLQLEQECLNVYKRKVEQAAKSRAHLLQALADAKHELSTLLASLGEKTFVGIPEKT 181 RDKMLLQLEQECL+VYKRKV+QA KSRAHLLQALADA+ ELS LL++LGEK+FVGIP+KT Sbjct: 37 RDKMLLQLEQECLDVYKRKVDQAVKSRAHLLQALADAQLELSRLLSALGEKSFVGIPDKT 96 Query: 182 SGTIKEQLAAI 214 SGTIKEQLAAI Sbjct: 97 SGTIKEQLAAI 107