BLASTX nr result
ID: Atractylodes21_contig00010112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00010112 (633 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272187.1| PREDICTED: protein Dr1 homolog [Vitis vinife... 67 3e-09 ref|XP_002511998.1| TATA-binding protein-associated phosphoprote... 65 1e-08 ref|XP_002328690.1| predicted protein [Populus trichocarpa] gi|2... 60 3e-07 ref|XP_003524506.1| PREDICTED: protein Dr1 homolog isoform 1 [Gl... 60 4e-07 ref|XP_003549817.1| PREDICTED: protein Dr1 homolog isoform 2 [Gl... 59 1e-06 >ref|XP_002272187.1| PREDICTED: protein Dr1 homolog [Vitis vinifera] gi|297734148|emb|CBI15395.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +3 Query: 3 EVLGFGDYIEEVYAAYEQHKLETVDTVRGGKCTNG 107 EVLGFG+YIEEVYAAYEQHKLET+DT++GGK +NG Sbjct: 80 EVLGFGEYIEEVYAAYEQHKLETMDTIKGGKWSNG 114 >ref|XP_002511998.1| TATA-binding protein-associated phosphoprotein, putative [Ricinus communis] gi|223549178|gb|EEF50667.1| TATA-binding protein-associated phosphoprotein, putative [Ricinus communis] Length = 155 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 3 EVLGFGDYIEEVYAAYEQHKLETVDTVRGGKCTNG 107 EVLGFG+YIEEVYAAYEQHKLET+D+++GGK +NG Sbjct: 80 EVLGFGEYIEEVYAAYEQHKLETMDSLKGGKWSNG 114 >ref|XP_002328690.1| predicted protein [Populus trichocarpa] gi|222838866|gb|EEE77217.1| predicted protein [Populus trichocarpa] Length = 156 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = +3 Query: 3 EVLGFGDYIEEVYAAYEQHKLETV-DTVRGGKCTNG 107 EVLGFG+YIEEVYAAYEQHKLET+ D+++GGK +NG Sbjct: 80 EVLGFGEYIEEVYAAYEQHKLETMHDSLKGGKWSNG 115 >ref|XP_003524506.1| PREDICTED: protein Dr1 homolog isoform 1 [Glycine max] Length = 156 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = +3 Query: 3 EVLGFGDYIEEVYAAYEQHKLETVDTVR-GGKCTNG 107 +VLGFG+Y+EEVYAAYEQHKLET+D++R GGK +NG Sbjct: 80 QVLGFGEYVEEVYAAYEQHKLETMDSLRGGGKWSNG 115 >ref|XP_003549817.1| PREDICTED: protein Dr1 homolog isoform 2 [Glycine max] Length = 159 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 EVLGFGDYIEEVYAAYEQHKLETVDTVRGG 92 +VLGFG+YIEEVYAAYEQHKLET+D++RGG Sbjct: 80 QVLGFGEYIEEVYAAYEQHKLETMDSLRGG 109