BLASTX nr result
ID: Atractylodes21_contig00009725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009725 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511170.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 ref|XP_002280267.2| PREDICTED: uncharacterized protein LOC100247... 75 4e-12 emb|CAN73867.1| hypothetical protein VITISV_001273 [Vitis vinifera] 75 4e-12 ref|XP_002318735.1| predicted protein [Populus trichocarpa] gi|2... 74 9e-12 ref|XP_003602802.1| Nodulin-like protein [Medicago truncatula] g... 68 9e-10 >ref|XP_002511170.1| conserved hypothetical protein [Ricinus communis] gi|223550285|gb|EEF51772.1| conserved hypothetical protein [Ricinus communis] Length = 589 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -2 Query: 169 DNEELTCYGTICYSITCGILSALCIIAVFLSMTVVYRTKSVYAQLYGNS 23 + E LTC G+ICYS+TCGI+S LCI+A+ LS+ VV+RT+SVYAQLYG + Sbjct: 539 EEESLTCVGSICYSLTCGIMSGLCIVAMILSLIVVHRTRSVYAQLYGKT 587 >ref|XP_002280267.2| PREDICTED: uncharacterized protein LOC100247479 [Vitis vinifera] gi|297734441|emb|CBI15688.3| unnamed protein product [Vitis vinifera] Length = 588 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/72 (51%), Positives = 51/72 (70%), Gaps = 8/72 (11%) Frame = -2 Query: 208 AKKQSSVKHYIFH--------DNEELTCYGTICYSITCGILSALCIIAVFLSMTVVYRTK 53 A+KQ+++K + +E L+C G ICYSITCG++S LC++AV LS+ VV+RTK Sbjct: 517 AEKQAALKQHSLGAMAGLPLGKDESLSCEGYICYSITCGVMSGLCLVAVVLSLIVVHRTK 576 Query: 52 SVYAQLYGNSRA 17 SVYA LYG S+A Sbjct: 577 SVYANLYGRSQA 588 >emb|CAN73867.1| hypothetical protein VITISV_001273 [Vitis vinifera] Length = 590 Score = 75.5 bits (184), Expect = 4e-12 Identities = 37/72 (51%), Positives = 51/72 (70%), Gaps = 8/72 (11%) Frame = -2 Query: 208 AKKQSSVKHYIFH--------DNEELTCYGTICYSITCGILSALCIIAVFLSMTVVYRTK 53 A+KQ+++K + +E L+C G ICYSITCG++S LC++AV LS+ VV+RTK Sbjct: 519 AEKQAALKQHSLGAMAGLPLGKDESLSCEGYICYSITCGVMSGLCLVAVVLSLIVVHRTK 578 Query: 52 SVYAQLYGNSRA 17 SVYA LYG S+A Sbjct: 579 SVYANLYGRSQA 590 >ref|XP_002318735.1| predicted protein [Populus trichocarpa] gi|222859408|gb|EEE96955.1| predicted protein [Populus trichocarpa] Length = 591 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -2 Query: 169 DNEELTCYGTICYSITCGILSALCIIAVFLSMTVVYRTKSVYAQLYGNS 23 + + LTC G CYS+TCGI+S LCIIAV LS+ VV RTKSVYAQLYGN+ Sbjct: 541 EEKSLTCVGLECYSLTCGIMSGLCIIAVILSLIVVRRTKSVYAQLYGNT 589 >ref|XP_003602802.1| Nodulin-like protein [Medicago truncatula] gi|355491850|gb|AES73053.1| Nodulin-like protein [Medicago truncatula] Length = 564 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -2 Query: 172 HDNEELTCYGTICYSITCGILSALCIIAVFLSMTVVYRTKSVYAQLYGNSRA 17 ++NE L C G ICYS+TCGIL+ +C++A LS+ +V RTK Y+QLYGN ++ Sbjct: 511 NNNELLLCEGNICYSLTCGILAVVCLVAAGLSLIIVQRTKRFYSQLYGNGKS 562