BLASTX nr result
ID: Atractylodes21_contig00009679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009679 (931 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555838.1| PREDICTED: anthranilate synthase component I... 64 2e-08 gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna ... 64 2e-08 ref|XP_002879228.1| hypothetical protein ARALYDRAFT_481885 [Arab... 62 4e-08 ref|NP_180530.1| anthranilate synthase component I-2 [Arabidopsi... 62 5e-08 dbj|BAD95154.1| anthranilate synthase, alpha subunit [Arabidopsi... 62 5e-08 >ref|XP_003555838.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Glycine max] Length = 567 Score = 63.9 bits (154), Expect(2) = 2e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 389 IIHLSSRKVTDRPLAGTIRRGKTHQEDYMLENQLLHDEKQCAD 261 + + RK+T+RPLAGT+RRGKT +ED MLE QLL+DEKQCA+ Sbjct: 348 LTRVKKRKITNRPLAGTVRRGKTPKEDIMLEKQLLNDEKQCAE 390 Score = 21.6 bits (44), Expect(2) = 2e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 268 VQIGRNDVGK 239 V +GRNDVGK Sbjct: 395 VDLGRNDVGK 404 >gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna speciosa] Length = 575 Score = 63.5 bits (153), Expect(2) = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 365 VTDRPLAGTIRRGKTHQEDYMLENQLLHDEKQCAD 261 +T+RPLAGT RRGKT +EDYMLE QLLHDEKQCA+ Sbjct: 364 ITNRPLAGTTRRGKTPKEDYMLETQLLHDEKQCAE 398 Score = 21.6 bits (44), Expect(2) = 2e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 268 VQIGRNDVGK 239 V +GRNDVGK Sbjct: 403 VDLGRNDVGK 412 >ref|XP_002879228.1| hypothetical protein ARALYDRAFT_481885 [Arabidopsis lyrata subsp. lyrata] gi|297325067|gb|EFH55487.1| hypothetical protein ARALYDRAFT_481885 [Arabidopsis lyrata subsp. lyrata] Length = 622 Score = 62.4 bits (150), Expect(2) = 4e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 389 IIHLSSRKVTDRPLAGTIRRGKTHQEDYMLENQLLHDEKQCAD 261 ++ +RK+T+RPLAGT+RRGKT +ED MLE +LL DEKQCA+ Sbjct: 390 LLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAE 432 Score = 21.9 bits (45), Expect(2) = 4e-08 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 7/65 (10%) Frame = -1 Query: 268 VQIGRNDVGKEE---IIELEQ----QRMQFTREVEFQRLNMFMETQLELEKMKKKRPSAT 110 V +GRNDVGK +E+E+ +R + ++ + ++ P T Sbjct: 437 VDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDNLTSWDALRAALPVGT 496 Query: 109 VSLSP 95 VS +P Sbjct: 497 VSGAP 501 >ref|NP_180530.1| anthranilate synthase component I-2 [Arabidopsis thaliana] gi|418134|sp|P32069.1|TRPX_ARATH RecName: Full=Anthranilate synthase component I-2, chloroplastic; Flags: Precursor gi|166606|gb|AAA32739.1| anthranilate synthase alpha subunit [Arabidopsis thaliana] gi|3582331|gb|AAC35228.1| anthranilate synthase, alpha subunit [Arabidopsis thaliana] gi|330253200|gb|AEC08294.1| anthranilate synthase component I-2 [Arabidopsis thaliana] Length = 621 Score = 62.4 bits (150), Expect(2) = 5e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 389 IIHLSSRKVTDRPLAGTIRRGKTHQEDYMLENQLLHDEKQCAD 261 ++ +RK+T+RPLAGT+RRGKT +ED MLE +LL DEKQCA+ Sbjct: 389 LLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAE 431 Score = 21.6 bits (44), Expect(2) = 5e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 268 VQIGRNDVGK 239 V +GRNDVGK Sbjct: 436 VDLGRNDVGK 445 >dbj|BAD95154.1| anthranilate synthase, alpha subunit [Arabidopsis thaliana] Length = 621 Score = 62.4 bits (150), Expect(2) = 5e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 389 IIHLSSRKVTDRPLAGTIRRGKTHQEDYMLENQLLHDEKQCAD 261 ++ +RK+T+RPLAGT+RRGKT +ED MLE +LL DEKQCA+ Sbjct: 389 LLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAE 431 Score = 21.6 bits (44), Expect(2) = 5e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 268 VQIGRNDVGK 239 V +GRNDVGK Sbjct: 436 VDLGRNDVGK 445