BLASTX nr result
ID: Atractylodes21_contig00009670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009670 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF74351.1| putative metal ion-binding protein [Arachis hypog... 77 3e-20 gb|AFK35490.1| unknown [Medicago truncatula] 61 3e-16 ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] g... 61 3e-16 gb|AFK36989.1| unknown [Medicago truncatula] 61 3e-16 ref|XP_002870162.1| hypothetical protein ARALYDRAFT_493247 [Arab... 59 4e-16 >gb|ACF74351.1| putative metal ion-binding protein [Arachis hypogaea] Length = 232 Score = 76.6 bits (187), Expect(2) = 3e-20 Identities = 38/53 (71%), Positives = 44/53 (83%), Gaps = 2/53 (3%) Frame = +1 Query: 244 KNRVKVIVVCCSPEKIRDKLCYKGGGAIQSIEIVE--KAEKPKDAGEKPKAVA 396 +N V + VVCCSPEKIRDKLCYKGGG+I+SIEIV+ K EK KDA +KPKA A Sbjct: 42 QNIVTITVVCCSPEKIRDKLCYKGGGSIKSIEIVDPPKPEKKKDADDKPKAPA 94 Score = 46.6 bits (109), Expect(2) = 3e-20 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +3 Query: 48 EKVTEMVLNVDLKCSGCYKKVKKVICKFP 134 EKVT M L VDL+C CYKKVKKV+ KFP Sbjct: 3 EKVTVMKLKVDLECHKCYKKVKKVLAKFP 31 >gb|AFK35490.1| unknown [Medicago truncatula] Length = 261 Score = 61.2 bits (147), Expect(2) = 3e-16 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +1 Query: 247 NRVKVIVVCCSPEKIRDKLCYKGGGAIQSIEIVEKAEKPK-DAGEKPK 387 N V + VVCCSPEKIRDK+C KG GAI+SIEIVE PK EKPK Sbjct: 47 NIVTITVVCCSPEKIRDKICCKGCGAIKSIEIVEPPPPPKPKEPEKPK 94 Score = 48.5 bits (114), Expect(2) = 3e-16 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 51 KVTEMVLNVDLKCSGCYKKVKKVICKFP 134 KVT M L VDL+C+ CYKKVKKV+CKFP Sbjct: 8 KVTIMKLKVDLQCAKCYKKVKKVLCKFP 35 >ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] gi|355511650|gb|AES92792.1| Proline-rich protein [Medicago truncatula] Length = 261 Score = 61.2 bits (147), Expect(2) = 3e-16 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +1 Query: 247 NRVKVIVVCCSPEKIRDKLCYKGGGAIQSIEIVEKAEKPK-DAGEKPK 387 N V + VVCCSPEKIRDK+C KG GAI+SIEIVE PK EKPK Sbjct: 47 NIVTITVVCCSPEKIRDKICCKGCGAIKSIEIVEPPPPPKPKEPEKPK 94 Score = 48.5 bits (114), Expect(2) = 3e-16 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 51 KVTEMVLNVDLKCSGCYKKVKKVICKFP 134 KVT M L VDL+C+ CYKKVKKV+CKFP Sbjct: 8 KVTIMKLKVDLQCAKCYKKVKKVLCKFP 35 >gb|AFK36989.1| unknown [Medicago truncatula] Length = 209 Score = 61.2 bits (147), Expect(2) = 3e-16 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +1 Query: 247 NRVKVIVVCCSPEKIRDKLCYKGGGAIQSIEIVEKAEKPK-DAGEKPK 387 N V + VVCCSPEKIRDK+C KG GAI+SIEIVE PK EKPK Sbjct: 47 NIVTITVVCCSPEKIRDKICCKGCGAIKSIEIVEPPPPPKPKEPEKPK 94 Score = 48.5 bits (114), Expect(2) = 3e-16 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 51 KVTEMVLNVDLKCSGCYKKVKKVICKFP 134 KVT M L VDL+C+ CYKKVKKV+CKFP Sbjct: 8 KVTIMKLKVDLQCAKCYKKVKKVLCKFP 35 >ref|XP_002870162.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. lyrata] gi|297315998|gb|EFH46421.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. lyrata] Length = 244 Score = 59.3 bits (142), Expect(2) = 4e-16 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +1 Query: 247 NRVKVIVVCCSPEKIRDKLCYKGGGAIQSIEIVEKAEKPKDAGEKP 384 N V + VVCCSPEKI DKLC KGGG+I++IEIVE + P+ ++P Sbjct: 47 NIVIIKVVCCSPEKIMDKLCSKGGGSIKTIEIVEPPKPPQPQAQQP 92 Score = 50.1 bits (118), Expect(2) = 4e-16 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +3 Query: 48 EKVTEMVLNVDLKCSGCYKKVKKVICKFP 134 EKVT M L VDL C+ CYKKVKKV+CKFP Sbjct: 7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFP 35