BLASTX nr result
ID: Atractylodes21_contig00009588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00009588 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511637.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002511637.1| conserved hypothetical protein [Ricinus communis] gi|223548817|gb|EEF50306.1| conserved hypothetical protein [Ricinus communis] Length = 132 Score = 57.4 bits (137), Expect = 1e-06 Identities = 50/107 (46%), Positives = 56/107 (52%), Gaps = 17/107 (15%) Frame = -1 Query: 279 PY--SKAGRVLSLLSSPKIEPGISSEDLSSRCSAALCELIAANRATTAVGNL-------W 127 PY S GR LSLLSS K + ISS DLSSR SAAL ELIA NRA L Sbjct: 6 PYLASPTGRALSLLSS-KADSWISSSDLSSRSSAALRELIAENRAAILTRQLVLERHLHH 64 Query: 126 NQNLPVIESTINSLPDT--------QMWDRFNNADHTTMTLDLMQAP 10 N + + S +S P T WDRF+ D T +TLDLMQ P Sbjct: 65 NNGIEDLGSD-HSQPSTNNSFTIPHHNWDRFHVPD-TQVTLDLMQTP 109