BLASTX nr result
ID: Atractylodes21_contig00008444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008444 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O23968.1|GPX4_HELAN RecName: Full=Probable phospholipid hydro... 74 9e-12 gb|AAQ03092.1| glutathione peroxidase [Malus x domestica] 70 2e-10 emb|CAJ43709.1| glutathion peroxidase [Plantago major] 70 2e-10 ref|NP_001237745.1| uncharacterized protein LOC100527297 [Glycin... 70 2e-10 ref|NP_001237193.1| uncharacterized protein LOC100306590 [Glycin... 70 2e-10 >sp|O23968.1|GPX4_HELAN RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase; Short=PHGPx; AltName: Full=Glutathione peroxidase 2 gi|2569989|emb|CAA75009.1| glutathione peroxidase [Helianthus annuus] Length = 180 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 308 KWNFTKFLVNGEGEVVDRYAPTTSPLSIEKDIKKLLNAA 192 KWNFTKFLV+ EG+VVDRYAPTTSPLSIEKDIKKLLN A Sbjct: 142 KWNFTKFLVDREGKVVDRYAPTTSPLSIEKDIKKLLNVA 180 >gb|AAQ03092.1| glutathione peroxidase [Malus x domestica] Length = 168 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 308 KWNFTKFLVNGEGEVVDRYAPTTSPLSIEKDIKKLLNAA 192 KWNF+KFLV+ EG+VVDRYAPTTSPLSIEKD+KKLL A Sbjct: 130 KWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLGVA 168 >emb|CAJ43709.1| glutathion peroxidase [Plantago major] Length = 168 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 308 KWNFTKFLVNGEGEVVDRYAPTTSPLSIEKDIKKLLNAA 192 KWNF+KFLV+ EG+VVDRYAPTTSPLSIEKD+KKLL A Sbjct: 130 KWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLEKA 168 >ref|NP_001237745.1| uncharacterized protein LOC100527297 [Glycine max] gi|255632031|gb|ACU16368.1| unknown [Glycine max] Length = 199 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 308 KWNFTKFLVNGEGEVVDRYAPTTSPLSIEKDIKKLLNA 195 KWNFTKFLVN EG+VVDRYAPTTSPL IEKDI+KLL + Sbjct: 162 KWNFTKFLVNKEGKVVDRYAPTTSPLKIEKDIEKLLQS 199 >ref|NP_001237193.1| uncharacterized protein LOC100306590 [Glycine max] gi|255628997|gb|ACU14843.1| unknown [Glycine max] Length = 166 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 308 KWNFTKFLVNGEGEVVDRYAPTTSPLSIEKDIKKLLNA 195 KWNFTKFLVN EG+VVDRYAPTTSPL IEKDI+KLL + Sbjct: 129 KWNFTKFLVNKEGKVVDRYAPTTSPLKIEKDIEKLLQS 166