BLASTX nr result
ID: Atractylodes21_contig00008318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008318 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528505.1| PREDICTED: uncharacterized protein LOC100802... 66 3e-09 ref|XP_002304137.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002521331.1| actin binding protein, putative [Ricinus com... 60 2e-07 ref|XP_003627267.1| hypothetical protein MTR_8g020530 [Medicago ... 59 4e-07 ref|NP_177404.1| hydroxyproline-rich glycoprotein family protein... 59 5e-07 >ref|XP_003528505.1| PREDICTED: uncharacterized protein LOC100802107 [Glycine max] Length = 161 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 5/58 (8%) Frame = -1 Query: 339 QHRKHR-----PPPPPLENLNVGKKLGFIFAGLAGILQICVVTFLVIKRRHLIKTHDR 181 + R+HR PPPPP +N GKK+G +F G+A I+Q+ VV FLVIKRR L+K+ DR Sbjct: 99 RRRRHRRPPPPPPPPPPHKMNAGKKVGLLFVGIAAIMQVGVVGFLVIKRRQLLKSDDR 156 >ref|XP_002304137.1| predicted protein [Populus trichocarpa] gi|222841569|gb|EEE79116.1| predicted protein [Populus trichocarpa] Length = 167 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = -1 Query: 351 GSKSQHRKHRPPPPPLEN----LNVGKKLGFIFAGLAGILQICVVTFLVIKRRHLIKTHD 184 G+ + R H PPPPP + +N GKK+G +F G+A ILQI VV FL KRR L+K +D Sbjct: 101 GNVMRRRSHPPPPPPPPSKNHQMNSGKKIGLLFVGIAAILQIGVVGFLAYKRRQLLKIND 160 Query: 183 RKHTNSS 163 R SS Sbjct: 161 RYEACSS 167 >ref|XP_002521331.1| actin binding protein, putative [Ricinus communis] gi|223539409|gb|EEF40999.1| actin binding protein, putative [Ricinus communis] Length = 210 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = -1 Query: 369 GSRNTLGSKSQHRKHRPPPPPLEN--LNVGKKLGFIFAGLAGILQICVVTFLVIKRRHLI 196 GSRN+ GS ++H + PPP N +N GKK+G +F G+A ILQI V+ FLV KR+ L+ Sbjct: 143 GSRNSHGSWTRHNR---PPPKNSNHSMNTGKKIGLLFVGIAAILQIGVIGFLVFKRKQLL 199 Query: 195 KTHDR 181 + R Sbjct: 200 RVQHR 204 >ref|XP_003627267.1| hypothetical protein MTR_8g020530 [Medicago truncatula] gi|355521289|gb|AET01743.1| hypothetical protein MTR_8g020530 [Medicago truncatula] Length = 168 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -1 Query: 336 HRKHRPP--PPPLENLNVGKKLGFIFAGLAGILQICVVTFLVIKRRHLIKTHD 184 H + PP PPP ++N GKK+G +F G+A I+Q+ V FLVIKRR L+KT+D Sbjct: 108 HVQLPPPLAPPPQHSMNAGKKVGLLFVGIAAIMQVGFVGFLVIKRRQLLKTND 160 >ref|NP_177404.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|334183868|ref|NP_001185384.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|12323771|gb|AAG51851.1|AC010926_14 hypothetical protein; 72245-71838 [Arabidopsis thaliana] gi|38454042|gb|AAR20715.1| At1g72600 [Arabidopsis thaliana] gi|45592904|gb|AAS68106.1| At1g72600 [Arabidopsis thaliana] gi|332197225|gb|AEE35346.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|332197226|gb|AEE35347.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] Length = 135 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = -1 Query: 339 QHRKHRPPPPPL-ENLNVGKKLGFIFAGLAGILQICVVTFLVIKRRH-LIKTHDR 181 +H KH PPPPP + +N GK +G FAG+A LQ+ V FL+ KRR L+K +DR Sbjct: 80 RHHKHPPPPPPKKQKVNTGKTVGLFFAGVAAALQVVVAAFLIFKRRQLLLKINDR 134