BLASTX nr result
ID: Atractylodes21_contig00008258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00008258 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270881.1| PREDICTED: F-box protein SKIP31 [Vitis vinif... 60 2e-07 >ref|XP_002270881.1| PREDICTED: F-box protein SKIP31 [Vitis vinifera] gi|296085460|emb|CBI29192.3| unnamed protein product [Vitis vinifera] Length = 305 Score = 60.1 bits (144), Expect = 2e-07 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +1 Query: 118 MTVSEDEDEHLAHFLESEVLSEISDQE-DAISEKEDVRQPKRLRVE 252 MTVSEDEDE+LAHFLESEVLSE SDQE DA++E+ Q KRLRV+ Sbjct: 1 MTVSEDEDENLAHFLESEVLSEASDQEKDAVAEQP---QAKRLRVD 43