BLASTX nr result
ID: Atractylodes21_contig00007941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00007941 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI83256.1| basic helix-loop-helix transcription factor [Hum... 76 2e-12 ref|XP_002527666.1| DNA binding protein, putative [Ricinus commu... 75 7e-12 gb|ACJ85411.1| unknown [Medicago truncatula] 73 2e-11 ref|XP_003628791.1| Transcription factor bHLH96 [Medicago trunca... 73 2e-11 ref|XP_002278824.1| PREDICTED: transcription factor bHLH71 [Viti... 72 5e-11 >emb|CBI83256.1| basic helix-loop-helix transcription factor [Humulus lupulus] Length = 318 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 108 PRVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 1 PRVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR Sbjct: 88 PRVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 123 >ref|XP_002527666.1| DNA binding protein, putative [Ricinus communis] gi|223532971|gb|EEF34737.1| DNA binding protein, putative [Ricinus communis] Length = 275 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 108 PRVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 1 PRVC+NKEEAETQRMTHIAVERNRRKQMNEHLAVLR Sbjct: 89 PRVCQNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 124 >gb|ACJ85411.1| unknown [Medicago truncatula] Length = 206 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 108 PRVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 1 PRVCKNKEEAETQR+THI VERNRRKQMNEHLAVLR Sbjct: 110 PRVCKNKEEAETQRITHITVERNRRKQMNEHLAVLR 145 >ref|XP_003628791.1| Transcription factor bHLH96 [Medicago truncatula] gi|355522813|gb|AET03267.1| Transcription factor bHLH96 [Medicago truncatula] Length = 312 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 108 PRVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 1 PRVCKNKEEAETQR+THI VERNRRKQMNEHLAVLR Sbjct: 100 PRVCKNKEEAETQRITHITVERNRRKQMNEHLAVLR 135 >ref|XP_002278824.1| PREDICTED: transcription factor bHLH71 [Vitis vinifera] Length = 315 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 105 RVCKNKEEAETQRMTHIAVERNRRKQMNEHLAVLR 1 RVCKNKEEAETQRMTHIAVERNRR+QMNEHLA+LR Sbjct: 87 RVCKNKEEAETQRMTHIAVERNRRRQMNEHLAILR 121