BLASTX nr result
ID: Atractylodes21_contig00007755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00007755 (534 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267457.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 81 8e-14 ref|XP_002509609.1| conserved hypothetical protein [Ricinus comm... 79 5e-13 ref|XP_002509613.1| immature colon carcinoma transcript, putativ... 78 9e-13 ref|NP_001148646.1| immature colon carcinoma transcript 1 protei... 78 9e-13 ref|XP_003549886.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 77 1e-12 >ref|XP_002267457.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial [Vitis vinifera] gi|296082846|emb|CBI22147.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = -2 Query: 533 AIIDAACYVPPPPSEEQVKKINKIAAIAESKRLQGKKVLSLKKAFRRSGGSYD 375 AIIDAA YVPPPPSEEQ KKI K+AAI E KRLQ KKVLS KKAFRRS S+D Sbjct: 178 AIIDAASYVPPPPSEEQKKKIAKLAAIGEQKRLQNKKVLSQKKAFRRSRDSWD 230 >ref|XP_002509609.1| conserved hypothetical protein [Ricinus communis] gi|223549508|gb|EEF50996.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 78.6 bits (192), Expect = 5e-13 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -2 Query: 533 AIIDAACYVPPPPSEEQVKKINKIAAIAESKRLQGKKVLSLKKAFRRSGGSYD 375 AIIDAA YVPPPPSEEQ KKI K+AA+ E KRL+ KKVLS KKAFRRS S+D Sbjct: 27 AIIDAASYVPPPPSEEQKKKIAKLAALGEQKRLKSKKVLSDKKAFRRSRNSWD 79 >ref|XP_002509613.1| immature colon carcinoma transcript, putative [Ricinus communis] gi|223549512|gb|EEF51000.1| immature colon carcinoma transcript, putative [Ricinus communis] Length = 234 Score = 77.8 bits (190), Expect = 9e-13 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = -2 Query: 533 AIIDAACYVPPPPSEEQVKKINKIAAIAESKRLQGKKVLSLKKAFRRSGGSYD 375 AIIDAA YVPPPPSEEQ KKI K+AAI E KRL+ KKVLS KKAFRRS S+D Sbjct: 182 AIIDAASYVPPPPSEEQKKKIAKLAAIGEQKRLKSKKVLSDKKAFRRSRISWD 234 >ref|NP_001148646.1| immature colon carcinoma transcript 1 protein [Zea mays] gi|195621084|gb|ACG32372.1| immature colon carcinoma transcript 1 protein precursor [Zea mays] gi|414865827|tpg|DAA44384.1| TPA: immature colon carcinoma transcript 1 protein isoform 1 [Zea mays] gi|414865828|tpg|DAA44385.1| TPA: immature colon carcinoma transcript 1 protein isoform 2 [Zea mays] Length = 227 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 533 AIIDAACYVPPPPSEEQVKKINKIAAIAESKRLQGKKVLSLKKAFRRSGGSYD 375 AIIDAA YVPPPP+E+Q KKI KIAA+AE KRLQ KKVLS KK FRR+ S+D Sbjct: 175 AIIDAASYVPPPPTEDQKKKIEKIAAVAERKRLQNKKVLSQKKEFRRNRTSWD 227 >ref|XP_003549886.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like [Glycine max] Length = 230 Score = 77.4 bits (189), Expect = 1e-12 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = -2 Query: 530 IIDAACYVPPPPSEEQVKKINKIAAIAESKRLQGKKVLSLKKAFRRSGGSYD 375 IIDAA YVPPPPSEEQ KKI K+AAI E KRL+ KKVLS KKAFRRS S+D Sbjct: 179 IIDAASYVPPPPSEEQKKKIAKMAAIGEQKRLKSKKVLSDKKAFRRSKNSWD 230