BLASTX nr result
ID: Atractylodes21_contig00007536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00007536 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554677.1| PREDICTED: probable translation initiation f... 52 8e-12 >ref|XP_003554677.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 1 [Glycine max] Length = 725 Score = 52.4 bits (124), Expect(2) = 8e-12 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 5/40 (12%) Frame = -1 Query: 207 NGDFILVSGDTVSNMMLTQALHEH-----KDYSAVMTMII 103 +GDF+L+SGDTVSNM LTQAL EH KD +AVMTM+I Sbjct: 125 HGDFVLISGDTVSNMSLTQALLEHKERKKKDSNAVMTMVI 164 Score = 42.4 bits (98), Expect(2) = 8e-12 Identities = 21/38 (55%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -2 Query: 107 LLIKQSKPSQVTRQTRI---DLIMAIDPGTK*LLYYED 3 ++IK+SKP+ Q+R+ +L MAIDP TK LLYYED Sbjct: 162 MVIKRSKPNPAIHQSRLGTDELFMAIDPNTKQLLYYED 199