BLASTX nr result
ID: Atractylodes21_contig00007437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00007437 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546655.1| PREDICTED: CTP synthase 1-like [Glycine max] 66 3e-09 ref|XP_003531808.1| PREDICTED: CTP synthase-like [Glycine max] 66 3e-09 ref|XP_002441549.1| hypothetical protein SORBIDRAFT_09g029130 [S... 66 3e-09 ref|XP_002303728.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 gb|ACJ83882.1| unknown [Medicago truncatula] 66 3e-09 >ref|XP_003546655.1| PREDICTED: CTP synthase 1-like [Glycine max] Length = 608 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 182 FNLQPINVDPYLNKDAGTMSPFEHGEVFVLDDGGEV 289 F + I +DPYLN DAGTMSPFEHGEVFVLDDGGEV Sbjct: 32 FRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >ref|XP_003531808.1| PREDICTED: CTP synthase-like [Glycine max] Length = 602 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 182 FNLQPINVDPYLNKDAGTMSPFEHGEVFVLDDGGEV 289 F + I +DPYLN DAGTMSPFEHGEVFVLDDGGEV Sbjct: 32 FRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >ref|XP_002441549.1| hypothetical protein SORBIDRAFT_09g029130 [Sorghum bicolor] gi|241946834|gb|EES19979.1| hypothetical protein SORBIDRAFT_09g029130 [Sorghum bicolor] Length = 605 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 182 FNLQPINVDPYLNKDAGTMSPFEHGEVFVLDDGGEV 289 F + I +DPYLN DAGTMSPFEHGEVFVLDDGGEV Sbjct: 32 FRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >ref|XP_002303728.1| predicted protein [Populus trichocarpa] gi|222841160|gb|EEE78707.1| predicted protein [Populus trichocarpa] Length = 595 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 182 FNLQPINVDPYLNKDAGTMSPFEHGEVFVLDDGGEV 289 F + I +DPYLN DAGTMSPFEHGEVFVLDDGGEV Sbjct: 32 FRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >gb|ACJ83882.1| unknown [Medicago truncatula] Length = 218 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 182 FNLQPINVDPYLNKDAGTMSPFEHGEVFVLDDGGEV 289 F + I +DPYLN DAGTMSPFEHGEVFVLDDGGEV Sbjct: 32 FRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEV 67