BLASTX nr result
ID: Atractylodes21_contig00007048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00007048 (626 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC81748.1| M355 [Lilium longiflorum] 56 6e-06 ref|XP_002515570.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >dbj|BAC81748.1| M355 [Lilium longiflorum] Length = 308 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 498 VFWAPAPLTVKSWAXXXXXXXXDYYATTAPPPVWG 394 VFWAPAPLTVKSWA DYYATTAPP WG Sbjct: 50 VFWAPAPLTVKSWADVEDDDDDDYYATTAPPSAWG 84 >ref|XP_002515570.1| conserved hypothetical protein [Ricinus communis] gi|223545514|gb|EEF47019.1| conserved hypothetical protein [Ricinus communis] Length = 309 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 498 VFWAPAPLTVKSWAXXXXXXXXDYYATTAPP-PVWG 394 VFWAPAPLTVKSWA DYYATTAPP PVWG Sbjct: 49 VFWAPAPLTVKSWADVDDEDDDDYYATTAPPVPVWG 84