BLASTX nr result
ID: Atractylodes21_contig00006933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00006933 (1038 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59230.1| hypothetical protein [Cacao swollen shoot virus] 79 2e-12 emb|CAG70340.1| hypothetical protein [Cacao swollen shoot virus] 78 4e-12 ref|NP_041732.1| hypothetical protein CSSVgp1 [Cacao swollen sho... 77 9e-12 emb|CAE81277.1| hypothetical protein [Cacao swollen shoot virus] 74 5e-11 ref|YP_006273073.1| hypothetical protein [Fig badnavirus 1] gi|3... 74 6e-11 >emb|CAD59230.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/64 (56%), Positives = 52/64 (81%) Frame = -1 Query: 330 LEKGLVNLTKTFTENQPLTASEVKKLVLEIAKQPKAVEEQTFQLTEDLNKKVERIEKMLH 151 +E L LTKTF EN+PLT SEV+KLV EIA+QPK VE+Q ++++ L +K+E++EK+LH Sbjct: 76 IEVALRRLTKTFRENKPLTESEVRKLVEEIAQQPKIVEKQALEISQQLEQKLEKVEKLLH 135 Query: 150 KVEQ 139 K++Q Sbjct: 136 KLDQ 139 >emb|CAG70340.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 77.8 bits (190), Expect = 4e-12 Identities = 36/64 (56%), Positives = 52/64 (81%) Frame = -1 Query: 330 LEKGLVNLTKTFTENQPLTASEVKKLVLEIAKQPKAVEEQTFQLTEDLNKKVERIEKMLH 151 +E L LTKTF EN+PLT SEV+KLV EIA+QPK VE+Q ++++ L +K+E++EK+LH Sbjct: 76 IEAVLRRLTKTFRENKPLTESEVRKLVEEIAQQPKIVEKQALEISQQLEQKLEKVEKLLH 135 Query: 150 KVEQ 139 K++Q Sbjct: 136 KLDQ 139 >ref|NP_041732.1| hypothetical protein CSSVgp1 [Cacao swollen shoot virus] gi|347869|gb|AAA03169.1| ORF1 [Cacao swollen shoot virus] Length = 143 Score = 76.6 bits (187), Expect = 9e-12 Identities = 35/64 (54%), Positives = 52/64 (81%) Frame = -1 Query: 330 LEKGLVNLTKTFTENQPLTASEVKKLVLEIAKQPKAVEEQTFQLTEDLNKKVERIEKMLH 151 +E L LTKTF E++PLT SEV+KLV EIA+QPK VE+Q ++++ L +K+E++EK+LH Sbjct: 76 IEVALRRLTKTFRESKPLTESEVRKLVEEIAQQPKIVEKQALEISQQLEQKLEKVEKLLH 135 Query: 150 KVEQ 139 K++Q Sbjct: 136 KLDQ 139 >emb|CAE81277.1| hypothetical protein [Cacao swollen shoot virus] Length = 143 Score = 74.3 bits (181), Expect = 5e-11 Identities = 35/64 (54%), Positives = 50/64 (78%) Frame = -1 Query: 330 LEKGLVNLTKTFTENQPLTASEVKKLVLEIAKQPKAVEEQTFQLTEDLNKKVERIEKMLH 151 +E L LTK F EN+PL+ SEVKKLV EIA+QPK VE+Q ++++ L K+E++EK+LH Sbjct: 76 VEVALRRLTKQFRENKPLSESEVKKLVEEIAQQPKIVEKQALEISQQLELKLEKVEKLLH 135 Query: 150 KVEQ 139 K++Q Sbjct: 136 KLDQ 139 >ref|YP_006273073.1| hypothetical protein [Fig badnavirus 1] gi|333493963|gb|AEF56562.1| hypothetical protein [Fig badnavirus 1] Length = 143 Score = 73.9 bits (180), Expect = 6e-11 Identities = 35/70 (50%), Positives = 52/70 (74%) Frame = -1 Query: 339 LAKLEKGLVNLTKTFTENQPLTASEVKKLVLEIAKQPKAVEEQTFQLTEDLNKKVERIEK 160 L LE + NLT+ F EN+PLT +EV++LV EI++QPK VE++ +LTE+L +K+ER+E Sbjct: 73 LESLELAVRNLTQVFVENKPLTTTEVRRLVYEISQQPKLVEQEALRLTEELRQKLERVEA 132 Query: 159 MLHKVEQCLS 130 ++ KVE S Sbjct: 133 IVKKVESWTS 142