BLASTX nr result
ID: Atractylodes21_contig00006739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00006739 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_195595.1| SAUR-like auxin-responsive protein [Arabidopsis... 102 4e-20 ref|XP_002868866.1| hypothetical protein ARALYDRAFT_490650 [Arab... 101 6e-20 dbj|BAJ34501.1| unnamed protein product [Thellungiella halophila] 100 9e-20 dbj|BAD43329.1| auxin-induced protein - like protein [Arabidopsi... 100 1e-19 ref|XP_004172954.1| PREDICTED: auxin-induced protein X10A-like [... 100 2e-19 >ref|NP_195595.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana] gi|4490336|emb|CAB38618.1| auxin-induced protein-like [Arabidopsis thaliana] gi|7270867|emb|CAB80547.1| auxin-induced protein-like [Arabidopsis thaliana] gi|62321722|dbj|BAD95347.1| auxin-induced protein - like [Arabidopsis thaliana] gi|88010988|gb|ABD38883.1| At4g38840 [Arabidopsis thaliana] gi|225898869|dbj|BAH30565.1| hypothetical protein [Arabidopsis thaliana] gi|332661582|gb|AEE86982.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana] Length = 99 Score = 102 bits (253), Expect = 4e-20 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 266 AVYVGEQEKKRFVVPVSLLRQPTFQELLRQAEEEFGYNHPMGGLTIPCSEDIFTDLASR 90 AVYVGEQ KRFVVPVS L QP+FQ+LLR+AEEEFG++HPMGGLTIPCSE+IF DLASR Sbjct: 39 AVYVGEQNMKRFVVPVSYLDQPSFQDLLRKAEEEFGFDHPMGGLTIPCSEEIFIDLASR 97 >ref|XP_002868866.1| hypothetical protein ARALYDRAFT_490650 [Arabidopsis lyrata subsp. lyrata] gi|297314702|gb|EFH45125.1| hypothetical protein ARALYDRAFT_490650 [Arabidopsis lyrata subsp. lyrata] Length = 98 Score = 101 bits (252), Expect = 6e-20 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = -1 Query: 266 AVYVGEQEKKRFVVPVSLLRQPTFQELLRQAEEEFGYNHPMGGLTIPCSEDIFTDLASR 90 AVYVGEQ+ KRFVVPVS L QP+FQ+LLR+AEEEFG++HPMGGLTIPCSE+IF +LASR Sbjct: 38 AVYVGEQKMKRFVVPVSYLNQPSFQDLLRKAEEEFGFDHPMGGLTIPCSEEIFIELASR 96 >dbj|BAJ34501.1| unnamed protein product [Thellungiella halophila] Length = 98 Score = 100 bits (250), Expect = 9e-20 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = -1 Query: 266 AVYVGEQEKKRFVVPVSLLRQPTFQELLRQAEEEFGYNHPMGGLTIPCSEDIFTDLASRL 87 AVYVGE + KRFVVP+S L QP+FQ+LLR+AEE+FG++HPMGGLTIPCSE+IF DLASRL Sbjct: 38 AVYVGETKMKRFVVPISYLNQPSFQDLLRKAEEQFGFHHPMGGLTIPCSEEIFMDLASRL 97 >dbj|BAD43329.1| auxin-induced protein - like protein [Arabidopsis thaliana] Length = 99 Score = 100 bits (249), Expect = 1e-19 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -1 Query: 266 AVYVGEQEKKRFVVPVSLLRQPTFQELLRQAEEEFGYNHPMGGLTIPCSEDIFTDLASR 90 AVYVGEQ KRFVVPVS L QP+FQ+LLR+AEEEFG++HP+GGLTIPCSE+IF DLASR Sbjct: 39 AVYVGEQNMKRFVVPVSYLDQPSFQDLLRKAEEEFGFDHPIGGLTIPCSEEIFIDLASR 97 >ref|XP_004172954.1| PREDICTED: auxin-induced protein X10A-like [Cucumis sativus] Length = 100 Score = 100 bits (248), Expect = 2e-19 Identities = 43/61 (70%), Positives = 53/61 (86%) Frame = -1 Query: 263 VYVGEQEKKRFVVPVSLLRQPTFQELLRQAEEEFGYNHPMGGLTIPCSEDIFTDLASRLG 84 VYVGE++KKRFV+P+S L QP+FQ+LL Q+EEEFGYNHPMGG+TIPCSED F D+ RL Sbjct: 39 VYVGEEQKKRFVIPLSYLNQPSFQDLLSQSEEEFGYNHPMGGITIPCSEDCFLDVTERLN 98 Query: 83 E 81 + Sbjct: 99 D 99