BLASTX nr result
ID: Atractylodes21_contig00006670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00006670 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159705.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_004135302.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 emb|CBI27550.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_002515001.1| pentatricopeptide repeat-containing protein,... 59 3e-07 >ref|XP_004159705.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Cucumis sativus] Length = 488 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -1 Query: 168 NIDFVIAKVQAGGTDDGIFQSLLHDQACSAMPVSHVLVCQLLCLFKDDWK 19 +IDF+IAKVQ G ++D +FQSLL D C+++ +SH LV +LL FKDDWK Sbjct: 39 DIDFIIAKVQVGSSEDEVFQSLLQDPVCNSIQLSHDLVYKLLQRFKDDWK 88 >ref|XP_004135302.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Cucumis sativus] Length = 519 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -1 Query: 168 NIDFVIAKVQAGGTDDGIFQSLLHDQACSAMPVSHVLVCQLLCLFKDDWK 19 +IDF+IAKVQ G ++D +FQSLL D C+++ +SH LV +LL FKDDWK Sbjct: 70 DIDFIIAKVQVGSSEDEVFQSLLQDPVCNSIQLSHDLVYKLLQRFKDDWK 119 >emb|CBI27550.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/56 (48%), Positives = 42/56 (75%) Frame = -1 Query: 186 CVGSPGNIDFVIAKVQAGGTDDGIFQSLLHDQACSAMPVSHVLVCQLLCLFKDDWK 19 C+ S ID ++++++ G +DD +F+SL+HD+AC+A+P+S LV LL FKDDWK Sbjct: 40 CIRS--QIDIIVSRIREGSSDDEVFKSLVHDEACNAIPMSQNLVDVLLHRFKDDWK 93 >ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/56 (48%), Positives = 42/56 (75%) Frame = -1 Query: 186 CVGSPGNIDFVIAKVQAGGTDDGIFQSLLHDQACSAMPVSHVLVCQLLCLFKDDWK 19 C+ S ID ++++++ G +DD +F+SL+HD+AC+A+P+S LV LL FKDDWK Sbjct: 40 CIRS--QIDIIVSRIREGSSDDEVFKSLVHDEACNAIPMSQNLVDVLLHRFKDDWK 93 >ref|XP_002515001.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546052|gb|EEF47555.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 466 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = -1 Query: 168 NIDFVIAKVQAGGTDDGIFQSLLHDQACSAMPVSHVLVCQLLCLFKDDWK 19 +ID ++AK++ G + D I QSL+HD+ C+++ +SH LV +LL FKDDWK Sbjct: 17 DIDVIVAKIRVGSSHDEIVQSLVHDEVCNSIHLSHELVDKLLFRFKDDWK 66