BLASTX nr result
ID: Atractylodes21_contig00006512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00006512 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF06706.1| UP-9A [Nicotiana tabacum] 59 4e-07 dbj|BAM64848.1| hypothetical protein [Beta vulgaris] 55 8e-06 >gb|ABF06706.1| UP-9A [Nicotiana tabacum] Length = 117 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = +2 Query: 197 LCSQLGEVEAEAMEQARAYREHLMTLMEQLAAAQKLIQSASV 322 LCSQLGE+EAEA++QAR YR ++ LM+QL+ AQKL++SAS+ Sbjct: 70 LCSQLGELEAEAVDQARTYRTRVIHLMDQLSLAQKLLESASI 111 >dbj|BAM64848.1| hypothetical protein [Beta vulgaris] Length = 103 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +2 Query: 197 LCSQLGEVEAEAMEQARAYREHLMTLMEQLAAAQKLIQSASV 322 LCSQLGE+EAEA++QAR +R ++ LME+L+ AQKL+Q S+ Sbjct: 55 LCSQLGELEAEAVDQARDFRARMLALMEELSKAQKLLQVHSI 96