BLASTX nr result
ID: Atractylodes21_contig00006431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00006431 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA26970.1| TO27-2rc [Taraxacum officinale] 65 6e-09 ref|XP_002282913.1| PREDICTED: zinc finger A20 and AN1 domain-co... 63 3e-08 gb|ACM68458.1| stress-associated protein 8 [Solanum pennellii] 61 1e-07 gb|ACM68445.1| stress-associated protein 8 [Solanum lycopersicum] 61 1e-07 ref|XP_004149261.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 2e-07 >gb|ABA26970.1| TO27-2rc [Taraxacum officinale] Length = 123 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -3 Query: 455 CNRRVGLXXXXXXXXXXXXXTHRYPEMHACTFDFKTMGKEAIAKANPV 312 C+RRVGL THRYPE+HACTFDFKT+GKEAI+KANP+ Sbjct: 67 CSRRVGLTGFTCKCGTTFCGTHRYPELHACTFDFKTIGKEAISKANPL 114 >ref|XP_002282913.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 4 isoform 1 [Vitis vinifera] Length = 161 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -3 Query: 455 CNRRVGLXXXXXXXXXXXXXTHRYPEMHACTFDFKTMGKEAIAKANPV 312 C +RVGL HRYPE H CTFDFKT+GKEAI+KANPV Sbjct: 105 CRKRVGLTGFRCRCGITFCGVHRYPEQHGCTFDFKTLGKEAISKANPV 152 >gb|ACM68458.1| stress-associated protein 8 [Solanum pennellii] Length = 151 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 455 CNRRVGLXXXXXXXXXXXXXTHRYPEMHACTFDFKTMGKEAIAKANPV 312 C +++GL THRYPE+HACTFDFK+MG+EAIAKANP+ Sbjct: 95 CKKKMGLMGFKCRCGTIFCGTHRYPEVHACTFDFKSMGREAIAKANPL 142 >gb|ACM68445.1| stress-associated protein 8 [Solanum lycopersicum] Length = 151 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 455 CNRRVGLXXXXXXXXXXXXXTHRYPEMHACTFDFKTMGKEAIAKANPV 312 C +++GL THRYPE+HACTFDFK+MG+EAIAKANP+ Sbjct: 95 CKKKMGLMGFRCKCGTIFCGTHRYPEVHACTFDFKSMGREAIAKANPL 142 >ref|XP_004149261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 3-like isoform 1 [Cucumis sativus] gi|449463080|ref|XP_004149262.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 3-like isoform 2 [Cucumis sativus] gi|449463082|ref|XP_004149263.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 3-like isoform 3 [Cucumis sativus] gi|449505428|ref|XP_004162466.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 3-like [Cucumis sativus] Length = 157 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/48 (58%), Positives = 29/48 (60%) Frame = -3 Query: 455 CNRRVGLXXXXXXXXXXXXXTHRYPEMHACTFDFKTMGKEAIAKANPV 312 C RRVGL +HRYPE H C FDFK MGKE IAKANPV Sbjct: 101 CRRRVGLTGFKCRCGMVYCGSHRYPEQHGCEFDFKQMGKEQIAKANPV 148