BLASTX nr result
ID: Atractylodes21_contig00006217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00006217 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002868646.1| hypothetical protein ARALYDRAFT_493925 [Arab... 74 1e-11 ref|NP_198874.1| proteasome subunit beta type-7-B [Arabidopsis t... 73 2e-11 ref|NP_001190443.1| proteasome subunit beta type-7-B [Arabidopsi... 73 2e-11 gb|AAM13010.1| 20S proteasome beta subunit PBB2 [Arabidopsis tha... 73 2e-11 emb|CAA73620.1| multicatalytic endopeptidase [Arabidopsis thaliana] 73 2e-11 >ref|XP_002868646.1| hypothetical protein ARALYDRAFT_493925 [Arabidopsis lyrata subsp. lyrata] gi|297314482|gb|EFH44905.1| hypothetical protein ARALYDRAFT_493925 [Arabidopsis lyrata subsp. lyrata] Length = 274 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 342 PNPRTYISSRGYTFSKKAEVLLTKITPLKELVEVVQVGGDAMEE 211 PNPRTY+SS+GY+F+KK EVLLTKITPL E VE+V+V G+AMEE Sbjct: 231 PNPRTYVSSKGYSFTKKTEVLLTKITPLSERVEIVEVAGEAMEE 274 >ref|NP_198874.1| proteasome subunit beta type-7-B [Arabidopsis thaliana] gi|30693626|ref|NP_851108.1| proteasome subunit beta type-7-B [Arabidopsis thaliana] gi|82581524|sp|Q7DLS1.2|PSB7B_ARATH RecName: Full=Proteasome subunit beta type-7-B; AltName: Full=20S proteasome beta subunit B-2; AltName: Full=Proteasome component FC; AltName: Full=Proteasome subunit beta type-2; Flags: Precursor gi|3421104|gb|AAC32067.1| 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] gi|9758084|dbj|BAB08528.1| 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] gi|332007184|gb|AED94567.1| proteasome subunit beta type-7-B [Arabidopsis thaliana] gi|332007185|gb|AED94568.1| proteasome subunit beta type-7-B [Arabidopsis thaliana] Length = 274 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 342 PNPRTYISSRGYTFSKKAEVLLTKITPLKELVEVVQVGGDAMEE 211 PNPRTY+SS+GY+F+KK EVLLTKITPL E VE+V+V G+AMEE Sbjct: 231 PNPRTYVSSKGYSFTKKTEVLLTKITPLLERVEIVEVAGEAMEE 274 >ref|NP_001190443.1| proteasome subunit beta type-7-B [Arabidopsis thaliana] gi|332007186|gb|AED94569.1| proteasome subunit beta type-7-B [Arabidopsis thaliana] Length = 268 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 342 PNPRTYISSRGYTFSKKAEVLLTKITPLKELVEVVQVGGDAMEE 211 PNPRTY+SS+GY+F+KK EVLLTKITPL E VE+V+V G+AMEE Sbjct: 225 PNPRTYVSSKGYSFTKKTEVLLTKITPLLERVEIVEVAGEAMEE 268 >gb|AAM13010.1| 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] gi|21387013|gb|AAM47910.1| 20S proteasome beta subunit PBB2 [Arabidopsis thaliana] Length = 274 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 342 PNPRTYISSRGYTFSKKAEVLLTKITPLKELVEVVQVGGDAMEE 211 PNPRTY+SS+GY+F+KK EVLLTKITPL E VE+V+V G+AMEE Sbjct: 231 PNPRTYVSSKGYSFTKKTEVLLTKITPLLERVEIVEVAGEAMEE 274 >emb|CAA73620.1| multicatalytic endopeptidase [Arabidopsis thaliana] Length = 218 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 342 PNPRTYISSRGYTFSKKAEVLLTKITPLKELVEVVQVGGDAMEE 211 PNPRTY+SS+GY+F+KK EVLLTKITPL E VE+V+V G+AMEE Sbjct: 175 PNPRTYVSSKGYSFTKKTEVLLTKITPLLERVEIVEVAGEAMEE 218