BLASTX nr result
ID: Atractylodes21_contig00005683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00005683 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521767.1| leucine-rich repeat-containing protein, puta... 57 2e-06 emb|CCD74496.1| similar to XP_002891963 predicted protein [A.lyr... 55 6e-06 >ref|XP_002521767.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223538980|gb|EEF40577.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 994 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Frame = -1 Query: 266 LSQLSHLRDLDLSSCKKLEVLPELPPTVHTLIASNCSSLQELQGR--VQDDQSYAFFNFT 93 +SQL LR L L CK L+ L +LP T+H + A+NC+SL+ L + D ++ F FT Sbjct: 683 ISQLPRLRFLYLDDCKNLKALRKLPTTIHEISANNCTSLETLSSPEVIADKWNWPIFYFT 742 Query: 92 GCHKLLMN 69 C KL +N Sbjct: 743 NCSKLAVN 750 >emb|CCD74496.1| similar to XP_002891963 predicted protein [A.lyrata] [Arabidopsis halleri subsp. halleri] Length = 1535 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = -1 Query: 269 CLSQLSHLRDLDLSSCKKLEVLPELPPTVHTLIASNCSSLQELQGRVQDDQSYAFFNFTG 90 CL L +L L LS C +L+ LPELP ++ L+ASNC SL+ L G + A NFT Sbjct: 1099 CLKGLHNLAFLTLSCCDRLKSLPELPSSLKHLLASNCESLERLSGPLNTPN--AQLNFTN 1156 Query: 89 CHKL 78 C KL Sbjct: 1157 CFKL 1160