BLASTX nr result
ID: Atractylodes21_contig00005561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00005561 (655 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152470.1| PREDICTED: probable 26S proteasome complex s... 55 9e-06 >ref|XP_004152470.1| PREDICTED: probable 26S proteasome complex subunit sem1-1-like [Cucumis sativus] Length = 73 Score = 55.5 bits (132), Expect = 9e-06 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -1 Query: 358 VKEEGKEVTQQWEXXXXXXXXXXDFSLQLRRELESNTEKK 239 +KEEGKE+TQQWE DFSLQLRRELESNTEKK Sbjct: 34 MKEEGKEITQQWEDDWDDDDVNDDFSLQLRRELESNTEKK 73