BLASTX nr result
ID: Atractylodes21_contig00005166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00005166 (1065 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593126.1| Zinc finger MYM-type protein [Medicago trunc... 58 3e-06 dbj|BAA36225.1| transposase [Ipomoea purpurea] 57 6e-06 >ref|XP_003593126.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355482174|gb|AES63377.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 754 Score = 58.2 bits (139), Expect = 3e-06 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -3 Query: 850 VASLTTDGSFSAMNIVKTRLRNKMEHEFLNDSLVLFIEKKFREDQF 713 V++ TT+ SFSAM ++KTRLRNKME EFL DS++L+IEK+ DQF Sbjct: 691 VSTATTERSFSAMKLIKTRLRNKMEDEFLADSMMLYIEKEI-ADQF 735 >dbj|BAA36225.1| transposase [Ipomoea purpurea] Length = 808 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 871 TFDLIYRVASLTTDGSFSAMNIVKTRLRNKMEHEFLNDSLVLFIEKK 731 T L V++ TT+ SFSAMNIVKT LRNKME EFL+D L+++IEK+ Sbjct: 738 TLVLTLPVSTATTERSFSAMNIVKTTLRNKMEDEFLSDCLLVYIEKQ 784